KEGG   Caenorhabditis elegans (nematode): CELE_F25B4.2Help
Entry
CELE_F25B4.2      CDS       T00019                                 

Gene name
peli-1
Definition
(RefSeq) PELI1 and PELI2 related
  KO
K11964  pellino [EC:2.3.2.27]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_F25B4.2 (peli-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     CELE_F25B4.2 (peli-1)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Pellino proteins
    CELE_F25B4.2 (peli-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pellino
Motif
Other DBs
NCBI-GeneID: 178959
NCBI-ProteinID: NP_504501
WormBase: WBGene00017766
Ensembl: WBGene00017766
UniProt: Q22967
Position
V:join(5709422..5709525,5709581..5709710,5709776..5709877,5709930..5709999,5710392..5710558,5710658..5711086,5711464..5711678,5711779..5711938)
Genome map
AA seq 458 aa AA seqDB search
MVDESELENGTPSPPAYSNEAILDDDIYGELILLGFNGQAENRATSKRYLTKKVLRRRDS
ANGIKKCTVHNVSTSDTKLTKDKARHTVSFHSDSNKSVVIEYAADPSKDMFQIGRASDDQ
IDFTVIDTWMFLPEHSDAAVPARPQIDVLEKGDRTSTISRFACRILIDRENSNKAYLYAA
GFDAHQNISINKKSLKWTKSNGEVDGLTTNGVLLLHPNKDDLLDDTVDKPMYKWREVSIN
GDVYEPRVTRSSSAKGVFVPEWTNMLQDGTLIDLCGATILWRTADGLERSPKMRELEMAL
DRLNAGRPQCPVNLNTLVIPKKRNGRQINRRQPYVYLQCGHVQGRHEWGVQENSGQRSGK
CPICLVESERIVQLSMGMEPSFHLDSGVLDHTFNPCGHMASKQTVLYWSRIPLPQGTCRY
DPVCPFCYQLLATERPFVRLIFQDNCFDDDTIRFSNEA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgaaagcgaattggaaaacggcacaccaagtccacctgcctactccaatgaa
gccattcttgacgatgatatttatggagagcttattcttttaggattcaatggtcaggct
gaaaatcgtgccacctcaaaaagatatctaacgaaaaaagttctaagacgacgtgattct
gcaaatggaatcaagaaatgtacagtacataatgtatcaacttcagataccaaactaacc
aaggacaaagcacggcacacagtttcatttcacagcgactctaacaaatcagtagttatt
gagtatgcagcagatccgtccaaagacatgtttcagattggtcgagcatcagatgatcag
attgatttcactgtaattgacacgtggatgtttctaccagagcattccgacgccgctgta
ccagctcgcccacaaatcgacgtactcgaaaagggagatcgaacatcgactatcagtaga
tttgcgtgtcgtattctgattgatcgagaaaattcaaataaagcatatttatacgcggca
ggattcgatgcacaccaaaatatttcaattaataaaaaatccttgaaatggacaaaatca
aacggagaagttgatggtctcacaacaaacggagttcttcttcttcacccaaataaagat
gatcttttggatgatacagttgacaaaccaatgtacaaatggcgtgaagtatcgattaat
ggagatgtctatgagccacgtgttactagaagtagttcggcaaaaggagtatttgtgcca
gagtggacaaatatgcttcaagatggaactttaattgatctttgtggagcaactatttta
tggagaacggctgatggattggagagatctccaaaaatgagagagctcgagatggcatta
gatcggttgaatgctggaagaccacaatgtccagttaacttgaatactcttgtgattccg
aagaaaaggaatggacggcaaattaataggagacaaccatatgtgtatctccaatgcgga
catgttcaaggaagacacgaatggggagttcaagagaatagtggtcaacgatcaggaaaa
tgtccgatttgtcttgtggaatcagagagaattgtgcagttatcaatgggaatggaacca
tcatttcatctcgattctggtgtactagatcacacttttaatccatgtggacacatggca
agcaagcaaactgtcttatactggtcccgcatccctctacctcaaggaacttgccgttac
gacccagtttgtccattctgctaccaacttttggcaacggaacgtccattcgttcgtctc
atttttcaagataattgctttgacgacgatacgattcgattttcaaacgaagcttga

DBGET integrated database retrieval system