KEGG   Caenorhabditis elegans (nematode): CELE_F25B5.4Help
Entry
CELE_F25B5.4      CDS       T00019                                 

Gene name
ubq-1
Definition
(RefSeq) Ubiquitin-related
  KO
K08770  ubiquitin C
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cel04121]
    CELE_F25B5.4 (ubq-1)
Ubiquitin system [BR:cel04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitins
   CELE_F25B5.4 (ubq-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2 DUF2407
Motif
Other DBs
NCBI-GeneID: 175840
NCBI-ProteinID: NP_741157
WormBase: WBGene00006727
Ensembl: WBGene00006727
UniProt: P0CG71
Position
III:join(5940991..5941357,5941408..5941863,5941917..5942600,5942649..5943332,5943383..5943708)
Genome map
AA seq 838 aa AA seqDB search
MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLIGKTITLEVEASDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGI
PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEAS
DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGDI
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcttcgtcaaaacgttgactggaaaaactatcaccctggaggtggaggcttcc
gataccatcgaaaatgtcaaagccaagatccaagacaaggaaggaattccaccagatcag
cagcgtctcatcttcgccggaaagcagctcgaggacggccgcaccctgtctgactacaac
atccagaaggaatctactcttcacttggttcttcgtcttagaggaggaatgcagatcttt
gtcaagactttgactggaaagaccatcacacttgaagttgaagcttccgacacgatcgag
aacgtcaaggccaagattcaagacaaggagggaatcccaccagatcagcagcgtcttatc
tttgctggaaagcaattggaagatggacgcacactctctgattacaatattcagaaagag
tctactctccacttggtgctccgcctcagaggaggtatgcagatcttcgtcaagacattg
actggaaagaccatcacacttgaagtcgaagcttccgacacgatcgaaaatgtcaaggct
aagattcaagataaagaaggaatcccaccagatcagcaaagacttatcttcgccggaaag
cagctcgaggacggccgcaccctttcggactacaacatccagaaggaatcaactcttcat
ttggttctccgtttgagaggaggtatgcagatcttcgtcaagacattgaccggaaagacc
atcaccctcgaagtcgaagcctccgacaccatcgaaaatgtcaaggccaagatccaagac
aaggaaggaattccaccagatcagcagagacttatttttgctggaaagcaactcgaggat
ggccgtaccctttcggactacaatatccagaaggaatcaaccctccatttggtgctccgc
ctaagaggaggaatgcagatcttcgtcaagactttgaccggaaagactattactcttgag
gttgaagcttctgacactattgagaacgtgaaggccaagatccaagacaaggaaggtatc
ccaccagatcaacagcgtttgatctttgccggaaagcaactcgaggatggccgtactctc
tccgattacaacatccaaaaggagtctactcttcatttggttctccgtctccgaggagga
atgcaaatcttcgtcaagactcttatcggaaagaccatcaccctcgaagtcgaagcctcc
gataccatcgagaacgtgaaggccaagattcaggacaaggaaggaattcctccagatcag
caacgtctcatcttcgctggaaagcagctcgaagacggccgcaccctttcggactacaac
atccagaaggaatcaactcttcatttggttctccgtttgagaggaggtatgcaaatcttc
gtgaagactttgactggaaagactatcaccctcgaagtcgaagcctctgataccatcgaa
aatgtgaaggccaagatccaagacaaggaaggaatcccaccagatcagcagcgtcttatc
tttgccggaaagcaattggaagatgggcgcacgctctctgattacaacattcagaaggaa
tctactcttcacttggttctccgtctccgaggaggaatgcagatcttcgtcaagactctt
acaggaaagaccatcacgctcgaggtggaagcttctgacactattgagaacgtgaaggcc
aagatccaagacaaagaaggtatcccaccagatcagcaacgcttgatcttcgccggaaag
caactcgaggatggccgtaccctttcggactacaatatccagaaggaatcaaccctccat
ttggtgctccgtctcagaggaggtatgcagatcttcgtcaagacattgactggaaagacc
atcacacttgaagtcgaagcctctgataccatcgagaatgtgaaggccaagattcaagac
aaggaaggaatcccaccagatcagcagagactcatcttcgccggaaaacaactcgaagac
ggtcgtaccctctccgactacaacatccaaaaggagtctactcttcatttggttctccgt
ctgagaggaggtatgcagatcttcgtcaagacattgaccggaaagaccatcaccctcgaa
gtcgaagcctccgacaccatcgaaaatgtcaaggccaagatccaagacaaggaaggaatt
ccaccagatcagcagagacttattttcgctggaaagcaactcgaggatggccgtaccctt
tcggactacaatatccagaaggagtctactcttcatttggtgctccgtctcagaggaggt
atgcagatcttcgtcaagactttgactggaaaaaccatcactctcgaggtcgaagcttcg
gacaccattgagaatgtcaaagccaaaatccaggataaggagggaatcccaccagatcag
caacgtttgatctttgctggaaagcagctcgaggatggacgcactctatccgattacaac
atccaaaaggagtcgacacttcatctcgttcttcgtcttcgcggaggagacatttaa

DBGET integrated database retrieval system