KEGG   Caenorhabditis elegans (nematode): CELE_F25H5.3Help
Entry
CELE_F25H5.3      CDS       T00019                                 

Gene name
pyk-1
Definition
(RefSeq) Pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel00230  Purine metabolism
cel00620  Pyruvate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01230  Biosynthesis of amino acids
Module
cel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cel_M00002  Glycolysis, core module involving three-carbon compounds
cel_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cel_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_F25H5.3 (pyk-1)
   00620 Pyruvate metabolism
    CELE_F25H5.3 (pyk-1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CELE_F25H5.3 (pyk-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F25H5.3 (pyk-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F25H5.3 (pyk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     CELE_F25H5.3 (pyk-1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CELE_F25H5.3 (pyk-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_F25H5.3 (pyk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 172744
NCBI-ProteinID: NP_492458
WormBase: WBGene00009126
Ensembl: WBGene00009126
UniProt: O17836
Position
I:join(9168463..9168489,9171477..9171592,9174995..9175202,9175280..9175954,9176002..9176121,9176517..9177015,9177073..9177116)
Genome map
AA seq 562 aa AA seqDB search
MASSQVQDVELAEAGDTINEVKASSASGRGRLARRMTIEEEHAGDYFKQEQKLAAVPATT
HMEHLCRLDIREAPHLVRQTGIICTIGPACASVEMLQKLILNGMNIARLNFSHGSHEYHA
GTIANVREAADSFSDKRVIGIALDTKGPEIRTGLLAGGASAEIELARGASIRLTTDPHFS
ESGTAVNLFVDYKNIAKVLSVGSRVYIDDGLISLIVEELQTDAVICSVENGGMLGSRKGV
NLPGTIVDLPAVSEKDCKDLQFGVEQGVDIIFASFIRNAEGIRTIRKVLGEKGKKIKIIA
KIENQEGVDNADEIISESDGVMVARGDLGIEIPAEKVFLAQKMLISKCNRAGKPVICATQ
MLESMVHKPRPTRAEGSDVANAVLDGADCVMLSGETAKGEYPVDALKIMHYICKEAEAAV
YHRRLFDELLQNTQKPTDMSHTIAIAATSAAASCHASAILLITTTGRSAIQCSRYKPAVP
ILTISRDVAVCRQLHLYRGVFPVHYPAERAADWPTDVDNRINHAIAIGKDRGFIHKGDFL
VVVTGWRQGAGATNTLRIITAE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatctcaggtacaagacgtcgagctcgccgaagccggagacaccatcaatgag
gtaaaggccagcagtgccagcggaagaggtcgtcttgctcgccgaatgaccatcgaagag
gagcatgctggtgattatttcaagcaagagcagaagctcgctgctgttccagccactacc
catatggagcatttgtgtcgtttggacattcgtgaggctccacatctcgttcgtcagacc
ggaattatttgcacaattggaccagcttgtgccagtgttgaaatgcttcaaaaattgatt
ctcaatggaatgaacattgctcgtctcaacttttcccatggatctcatgagtaccatgcc
ggaaccatcgccaacgttcgtgaagctgccgattcattctctgacaagcgtgtcattgga
attgctttggacacgaagggacctgaaatccgtactggacttcttgccggcggtgcttct
gctgaaattgagcttgcacgaggagcatcaatccgtttgactactgatccacacttttct
gaatcaggaactgctgtcaatctttttgttgattacaagaacattgccaaagttctttcg
gttggatcccgtgtctacattgatgacggacttatctcattgattgtcgaagaattgcaa
actgacgctgtcatttgctctgttgaaaatggtggaatgttgggaagcagaaagggagtc
aatcttccaggaactatcgttgatttgccagctgtttccgagaaggactgtaaggatttg
cagtttggtgtggaacaaggtgttgatatcatctttgcttcattcatccgaaacgctgaa
ggaattcgtacgattcgtaaagttctcggagagaaaggaaagaagattaagattattgca
aagattgagaatcaagaaggagttgataatgctgatgaaattatctctgaatctgatgga
gttatggttgctcgtggagatctcggtatcgaaattccagccgagaaggtgttccttgca
caaaagatgctcatctccaagtgtaatcgtgctggaaaacctgtcatttgtgcaactcag
atgcttgaatcgatggttcacaagccacgtccaaccagagctgaaggatcagatgttgcc
aatgctgtgcttgacggagctgattgtgtgatgctttctggagagactgctaaaggagaa
tatccagttgatgcactcaagatcatgcattatatatgcaaagaagccgaagcagcagtt
tatcatcgtcgtctcttcgatgaacttcttcaaaacacacaaaaaccaactgacatgtct
catactattgctatcgctgccacatctgcagctgcatcgtgccatgcttcagcaattctt
ctcattaccaccactggacgctcggcaatccaatgctctcgctacaagccagccgtccca
attctgacaatctcgagagacgttgctgtgtgccgtcagcttcatctttacagaggagtt
ttcccagttcattatccagctgaacgtgctgccgattggccaactgatgttgataacaga
atcaaccatgctatcgccatcggaaaggatcgtggattcattcacaagggtgacttcttg
gttgttgtcactggatggagacagggagccggagctaccaacactcttcgtatcatcacc
gccgaataa

DBGET integrated database retrieval system