KEGG   Caenorhabditis elegans (nematode): CELE_F28C10.3
Entry
CELE_F28C10.3     CDS       T00019                                 

Gene name
F28C10.3
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 180405
NCBI-ProteinID: NP_508114
WormBase: WBGene00017898
Ensembl: WBGene00017898
UniProt: Q19858
Position
X:complement(join(532286..532349,532926..533017,533701..533871,533916..534064,534366..534500,534555..534765,535314..535415,535465..535531,535689..535747))
AA seq 349 aa
MTECPESSTNMTNGENGENHAPAATIEDFEILKHIGSGAYGEVAAVRKLNGCDTETIYAM
KVMEKRRMSKHKDMVEHEWKILTTIHNPFFMKMSYSFQTKRHLVFVMPFAGGGDMLTMME
NECLIEESAHFYLCELVEGIGYLHEKHIVHRDVKLENLLIGNDGHLMITDYGLSATGCDA
EDAIQGVIGTRHTMAPEVHLEKKYGTSCDWWAVGITYCDMRSDKAVFDGADSKEYSDSTA
KKRPRLPKVLSPRERGFVNKLIVRDPTQRLGNGPDGTATVKAHDMFKGVVWEDVLAKKLV
PPFIPDAEMISTFKCFPEQTKQTKFPTFEHPVPLYWTDIDFTDPSLCNN
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacagagtgtccggagtcgtccacaaacatgacgaacggcgagaatggagaaaatcat
gcaccagccgccacaatcgaagattttgaaattctgaagcacatcggaagcggagcatat
ggagaggtggccgccgtacgcaagcttaatgggtgcgatactgaaacgatttatgcgatg
aaagtgatggagaagagaaggatgtccaagcacaaggatatggttgagcacgaatggaag
atcctcaccacaatccacaacccgttcttcatgaaaatgagctactcgttccagacgaaa
cggcatttggtttttgttatgccttttgctggcggtggtgacatgctcacaatgatggaa
aatgagtgtttgatcgaggaatctgctcatttttacttgtgtgagcttgttgaagggatc
ggataccttcatgaaaaacacatcgttcacagagacgttaagctggagaatcttctaatt
ggaaatgatggacacttgatgattacggattatggtctttcagctactggatgtgacgct
gaagacgctatccagggtgtaatcggaactcgccataccatggccccggaggtacacctg
gagaaaaagtacggcacttcctgcgactggtgggctgttggaatcacttattgcgatatg
cgttccgacaaggctgtatttgatggcgctgacagcaaagagtactctgatagcactgca
aagaagcgcccacgacttccaaaagttttaagcccacgtgagagaggttttgtcaacaaa
ctgattgtccgcgatccgacgcaacgtcttggcaacggaccggacggaactgcaactgtc
aaggcacatgatatgttcaaaggagttgtctgggaggatgtgctcgccaagaagcttgtg
ccaccattcattccggatgctgagatgatcagcaccttcaagtgcttcccggagcaaacc
aaacagacgaagttcccgacctttgaacaccctgtcccactttactggactgatattgac
ttcacggacccatccctgtgcaacaactag

DBGET integrated database retrieval system