KEGG   Caenorhabditis elegans (nematode): CELE_F28C6.7Help
Entry
CELE_F28C6.7      CDS       T00019                                 

Gene name
rpl-26
Definition
(RefSeq) 60S ribosomal protein L26
  KO
K02898  large subunit ribosomal protein L26e
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03010  Ribosome
Module
cel_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CELE_F28C6.7 (rpl-26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cel03011]
    CELE_F28C6.7 (rpl-26)
Ribosome [BR:cel03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    CELE_F28C6.7 (rpl-26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L26 KOW
Motif
Other DBs
NCBI-GeneID: 174379
NCBI-ProteinID: NP_495823
WormBase: WBGene00004440
Ensembl: WBGene00004440
UniProt: Q19869
Position
II:join(8602793..8602941,8603115..8603271,8603425..8603547)
Genome map
AA seq 142 aa AA seqDB search
MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRG
RHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVAITKLKLDKDRRALVER
KAAGRSRVTGILKGKHTDETVN
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaatccgttcgtctccagcgattccggaaagagccgcaaggcccacttcaac
gctccatcccacgagcgcagacgcatcatgtctgccccactcaccaaggagctccgcacc
aagcacggaatccgtgctattccaatcagaaccgatgatgaggtcgtcgttatgcgcgga
cgccataagggaaacactggacgtgtcctcagatgctaccgtaagaagttcgttatccac
atcgacaagatcacccgcgagaaggctaacggatccactgtgcacatcggaatccaccct
tcgaaggtcgctatcaccaagctgaagctcgataaggatcgtcgtgccctcgttgagcgc
aaggctgccggacgttcccgcgtcactggaatcctcaagggaaagcacactgacgagacc
gtcaactaa

DBGET integrated database retrieval system