KEGG   Caenorhabditis elegans (nematode): CELE_F28H6.1Help
Entry
CELE_F28H6.1      CDS       T00019                                 

Gene name
akt-2
Definition
(RefSeq) Serine/threonine-protein kinase akt-2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04933  AGE-RAGE signaling pathway in diabetic complications
Module
cel_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F28H6.1 (akt-2)
   04012 ErbB signaling pathway
    CELE_F28H6.1 (akt-2)
   04068 FoxO signaling pathway
    CELE_F28H6.1 (akt-2)
   04150 mTOR signaling pathway
    CELE_F28H6.1 (akt-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_F28H6.1 (akt-2)
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F28H6.1 (akt-2)
   04213 Longevity regulating pathway - multiple species
    CELE_F28H6.1 (akt-2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    CELE_F28H6.1 (akt-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F28H6.1 (akt-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_F28H6.1 (akt-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   CELE_F28H6.1 (akt-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Kinase-like Pkinase_C Haspin_kinase PH_11
Motif
Other DBs
NCBI-GeneID: 181524
NCBI-ProteinID: NP_510357
WormBase: WBGene00000103
Ensembl: WBGene00000103
UniProt: Q9XTG7
Position
X:join(14147707..14147801,14148005..14148113,14149006..14149206,14149250..14149369,14149594..14149791,14150263..14150454,14150565..14150693,14150741..14151103,14151381..14151560)
Genome map
AA seq 528 aa AA seqDB search
MSTENAHLQKEDIVIESWLHKKGEHIRNWRPRYFILFRDGTLLGFRSKPKEDQPLPEPLN
NFMIRDAATVCLDKPRPNMFIVRCLQWTTVIERTFYADSADFRQMWIEAIQAVSSHNRLK
ENAGNTSMQEEDTNGNPSGESDVNMDATSTRSDNDFESTVMNIDEPEEVPRKNTVTMDDF
DFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACVHPFL
TLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIV
YRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVD
WWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEAVTLLSGLLERVPAKR
LGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQLTP
PRRGEELPTVDEEEELQANFIQFASYYVSGSLERSYDTNRSADKYEIR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgaaaacgcccatctacaaaaagaagacattgttattgaaagttggcttcac
aagaaaggagagcacattcgtaattggcgccccaggtacttcatcttgtttcgagatgga
acgttgcttggattccggtcaaagccaaaggaagatcagccgttaccagagccactgaat
aattttatgattagagacgcagcgacggtttgccttgacaaacctcgaccaaatatgttt
atcgtgcgatgtctccaatggaccactgtcattgaacgcacattttatgcggatagcgcc
gacttccgtcagatgtggattgaagcaattcaagctgtatccagtcacaatcgtttgaaa
gaaaatgcaggaaataccagcatgcaggaggaagatactaatggaaatccgtctggagaa
agtgatgtgaacatggacgcaacaagcacccgttcggataatgattttgagtcaactgta
atgaatatcgacgaaccagaggaagttccaagaaaaaatacagtgacgatggacgatttt
gacttcctcaaagttctcggtcaaggaaccttcggaaaagttattttgtgcagggagaaa
agttctgataagctctacgccattaagattatcagaaaagaaatggtcgttgatcgttct
gaggtggcccacactttgactgaaaatcgagttctgtatgcttgcgttcacccttttctc
acgctacttaaatacagtttccaagcacaatatcacatctgttttgtgatggagtttgca
aatggtggcgagctgttcacccatcttcagaggtgcaaaacattcagcgaagcacgaaca
agattttatggatcggaaatcatacttgctcttggataccttcatcacagaaatattgtg
tatcgtgatatgaaactcgaaaatttgcttctcgacagagatggtcacatcaaaatcact
gactttgggttgtgcaaagaggaaatcaaatatggagataaaacaagcaccttttgcgga
acaccagaataccttgcaccagaggttatcgaagacatcgactatgaccgtagtgttgac
tggtggggagtcggagtggtcatgtacgaaatgatgtgtggacggcttccattttcagca
aaggagaacggcaaactcttcgaactaattacgacatgtgatttgaagttcccgaatagg
ttaagcccagaagccgtaacattactatctggactactcgaaagggtcccagctaagcgg
cttggtgccggtcctgatgatgcacgtgaagtttcgagagctgaatttttcaaagatgtg
gattgggaagcaacattaagaaaagaagtcgaacctccatttaagccaaatgtgatgtct
gaaacggacacgagtttctttgacagagagttcacatcaatgccggtccaactgacgcct
ccacgtagaggggaagaacttccgacagttgatgaggaagaagaattacaagccaacttc
atacaatttgcgtcatactacgtgtcgggaagcttggaacgatcttatgatacgaacaga
agcgctgacaaatacgaaataagatga

DBGET integrated database retrieval system