KEGG   Caenorhabditis elegans (nematode): CELE_F30A10.6
Entry
CELE_F30A10.6     CDS       T00019                                 

Gene name
sac-1
Definition
(RefSeq) SAC domain-containing protein
  KO
K21797  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00562  Inositol phosphate metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_F30A10.6 (sac-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_F30A10.6 (sac-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     CELE_F30A10.6 (sac-1)
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 172778
NCBI-ProteinID: NP_492518
WormBase: WBGene00009264
Ensembl: WBGene00009264
UniProt: Q93641
Position
I:join(9488497..9488653,9488701..9489235,9489475..9490145,9491987..9492310,9492389..9492498)
AA seq 598 aa
MVDSLLSMDIYESFNLYSHPEKFFLEPTDLGGGAASKHYLEIDRHTNVMKIIDSRKQRVP
IADTDIKFIYGILGTIKLVSGYALIVITKASLIGQVNNHNIWTIQDAEIIPYKKTTLHLT
EKQIRYNRLFTDMLTHVLSIGGFYYSTTLDISRTFQWLQENAVPLFKTRSMLDRASERFI
WNGHLLSQIRQVPGAERYTLPVIHGFIGQNRVNVNGKEIKLTIISRRSIYRAGVRFYKRG
VDVDGHAANFVETEQIVEYTNPDKHLTSFVQLRGSIPLLWTQKPNLRWQPMPTLKPTDDQ
LAAFNRAFSWHKQHYGGKHVIVNLVNQKGREKKVGGELERISRQANIEFVRYHQFDFHKE
CHSMQWHRIDLLREQLSQEISSFGYFYLSPNSMETSRFQRGFFRTNCMDCLDRTNVVQSM
LARESLTEQLRMLGILYSEQKVQDIPLLEDAFKQMWADNGDECSRQYAGTGALKADFTRH
GRRTYVGAMKDGVNAVSRYVRNNFGDGYRQDSIDLFLGNFLVDSSDLPVSLESSILSTDQ
NGLALIAALFAMSMTILCLLVADNFTATIFWMVIFFVCMMFIFLNGEEFVNAPKLKLD
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggtggatagtctattgagtatggacatctacgagagtttcaacttgtactcacaccca
gaaaaattcttcttagaaccaaccgatctcggcggtggtgctgcgtcgaaacattatctc
gaaatcgatagacacacaaatgtgatgaaaattattgattcacgcaagcagcgagttcca
attgctgatacggacatcaagtttatttatgggattttgggaacaattaaactagtctca
ggatatgctttgatcgtaataacaaaggcttctttgatcggacaagttaataatcacaac
atctggactattcaagatgccgagattattccttacaagaaaacaacacttcacttgact
gagaaacaaattagatataatagattattcactgatatgctcactcatgtgctgtctatt
ggcggattctactactcgacgactcttgacatctcacgcacatttcaatggcttcaggag
aacgctgttcctttgttcaaaacaagaagtatgttggacagagccagcgaacgtttcata
tggaatggacatctactgtcacagatccggcaggtccctggtgcagaaagatacacattg
cccgttattcatggttttattggccagaatcgtgtgaatgtgaatggaaaagagattaaa
ttgactatcatatccagaagaagcatttatcgtgctggcgtccgtttctataaacgtgga
gtcgacgtagatggtcatgcagcaaactttgttgaaacagaacaaatcgttgaatacacg
aatcctgacaagcacctgacttcgtttgtgcaattgagaggttctattcctcttctctgg
actcaaaaaccaaatctacgttggcaaccgatgcctacactgaaaccaacagatgaccag
cttgctgctttcaatcgagctttttcgtggcacaagcaacactatggtggtaaacatgtg
attgtaaatcttgtaaatcaaaaaggaagagagaaaaaagttggaggagaactggagaga
atatcacgacaagcaaatatcgaatttgttcgttaccatcaatttgattttcacaaagaa
tgtcattctatgcaatggcaccgaattgatttgttgcgggagcagttaagccaagaaatt
tcgagttttggatatttttacttgtccccgaatagtatggaaacaagtcgattccaacgt
ggatttttccgtacgaattgcatggattgtctagatcgtaccaatgtggttcagtcgatg
ttggcacgtgaatcactcaccgaacaacttcgaatgcttggaattttatattcagagcag
aaagttcaagatattccacttcttgaagatgcattcaaacaaatgtgggcagataatggt
gatgaatgtagtcgtcaatatgctggaacaggcgcattgaaagcagatttcactcgtcac
ggaagacggacatatgttggagcaatgaaagacggtgtcaatgcagtgtcccgttacgta
cgaaataattttggagatggataccgtcaagattcaattgatctcttccttggtaacttc
ctagtcgattcgtcagatcttcctgtttcgctggaatcttcgattctatcaacggatcag
aatggtcttgcccttattgccgcgttgtttgccatgtcaatgacaattctttgtcttttg
gttgcagacaacttcaccgcaacaatcttctggatggtcattttctttgtctgtatgatg
ttcatatttttgaacggcgaagaatttgtaaatgctccgaagctcaaactggactaa

DBGET integrated database retrieval system