KEGG   Caenorhabditis elegans (nematode): CELE_F31E3.5
Entry
CELE_F31E3.5      CDS       T00019                                 

Gene name
eef-1A.1
Definition
(RefSeq) Elongation factor 1-alpha
  KO
K03231  elongation factor 1-alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    CELE_F31E3.5 (eef-1A.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_F31E3.5 (eef-1A.1)
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_F31E3.5 (eef-1A.1)
   03012 Translation factors [BR:cel03012]
    CELE_F31E3.5 (eef-1A.1)
   04131 Membrane trafficking [BR:cel04131]
    CELE_F31E3.5 (eef-1A.1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F31E3.5 (eef-1A.1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     CELE_F31E3.5 (eef-1A.1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    CELE_F31E3.5 (eef-1A.1)
Translation factors [BR:cel03012]
 Eukaryotic type
  Elongation factors
   CELE_F31E3.5 (eef-1A.1)
Membrane trafficking [BR:cel04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    CELE_F31E3.5 (eef-1A.1)
Exosome [BR:cel04147]
 Exosomal proteins
  Proteins found in most exosomes
   CELE_F31E3.5 (eef-1A.1)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Semialdhyde_dhC NIF3
Other DBs
NCBI-GeneID: 175975
NCBI-ProteinID: NP_498520
WormBase: WBGene00001168
Ensembl: WBGene00001168
UniProt: P53013
Position
III:complement(join(6970139..6970396,6970446..6971266,6971315..6971483,6971537..6971680))
AA seq 463 aa
MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
DKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGT
GEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKK
IGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERKEGNASGKTLLEALDSIIPPQR
PTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLP
EAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPV
LDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAP
LGRFAVRDMRQTVAVGVIKSVEKSDGSSGKVTKSAQKAAPKKK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgggaaaagaaaaggttcatatcaacatcgtcgtcatcggacacgtcgactccggaaag
tccaccacaactggacacttgatctacaagtgcggaggaattgacaagagaaccatcgag
aagttcgagaaggaggctcaggagatgggtaagggatctttcaagtacgcttgggtcctc
gacaagctgaaggccgagcgtgaacgtggtatcaccatcgatatcgctctctggaagttc
gagactgccaagtactacatcaccatcatcgatgccccaggacatcgtgatttcatcaag
aacatgatcactggaacatcccaggccgattgcgccgtcttggtcgtcgcttgcggaact
ggagaattcgaggccggaatctccaagaacggacaaactcgcgagcacgctcttcttgcc
cagacccttggagtcaagcaactcatcgttgcctgcaacaagatggactccaccgagcca
ccattctctgaggcccgtttcaccgagatcaccaacgaggtttctggattcatcaagaag
atcggatacaatccaaaggctgttccattcgtcccaatctctggattcaacggagacaac
atgcttgaggtctcctccaacatgccatggttcaagggatgggccgttgagcgcaaggaa
ggaaacgcttccggaaagaccctcctcgaggctctcgactccatcattccaccacaacgc
ccaactgaccgaccactccgtctcccactccaggatgtgtacaagatcggaggaatcgga
actgttccagtcggacgtgttgagaccggaatcatcaagccaggaatggtcgttaccttc
gctccacaaaacgtcaccactgaagtcaagtccgttgagatgcatcacgaatctcttcca
gaggccgtcccaggagacaacgttggattcaacgtcaagaacgtctccgtcaaggatatt
cgtcgtggatccgtctgctccgactccaagcaagacccagccaaggaggctcgcaccttc
cacgcccaggtcatcatcatgaaccatccaggacagatctccaacggatacactccagtt
ctcgattgccacaccgctcacatcgcctgcaagttcaacgagcttaaggagaaggttgac
cgtcgtaccggtaagaaggttgaggacttcccaaagttcctcaagtctggagatgctgga
atcgtcgagctcatcccaaccaagccactttgtgttgaatccttcaccgactacgctcca
ctcggacgtttcgccgttcgtgacatgagacaaaccgtcgctgtcggagttatcaagtcc
gttgagaagtctgatggatcctctggaaaggtcaccaagtccgcccaaaaggctgcacca
aagaagaagtaa

DBGET integrated database retrieval system