KEGG   Caenorhabditis elegans (nematode): CELE_F32B5.8Help
Entry
CELE_F32B5.8      CDS       T00019                                 

Gene name
cpz-1
Definition
(RefSeq) CathePsin Z
  KO
K08568  cathepsin X [EC:3.4.18.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_F32B5.8 (cpz-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F32B5.8 (cpz-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     CELE_F32B5.8 (cpz-1)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C1: papain family
   CELE_F32B5.8 (cpz-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 171829
NCBI-ProteinID: NP_491023
WormBase: WBGene00000788
Ensembl: WBGene00000788
UniProt: G5EGP8
Position
I:complement(join(2686698..2687119,2687690..2687893,2687950..2687973,2689086..2689210,2689270..2689415))
Genome map
AA seq 306 aa AA seqDB search
MRTFVLLLALCAICILASSAYGKVRKYSNRNRYNLKGCYKQTGRVFEHKRYDRIYETEDF
DSEDLPKTWDWRDANGINYASADRNQHIPQYCGSCWAFGATSALADRINIKRKNAWPQAY
LSVQEVIDCSGAGTCVMGGEPGGVYKYAHEHGIPHETCNNYQARDGKCDPYNRCGSCWPG
ECFSIKNYTLYKVSEYGTVHGYEKMKAEIYHKGPIACGIAATKAFETYAGGIYKEVTDED
IDHIISVHGWGVDHESGVEYWIGRNSWGEPWGEHGWFKIVTSQYKNAGSKYNLKIEEDCV
WADPIV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacttttgtgctccttcttgcactttgtgcgatttgtattctagcttcttcggct
tatggcaaggttcggaagtattccaaccgcaatcgctataacctgaagggatgctacaag
caaactggaagagtctttgagcataaacgttacgatagaatctacgagactgaagacttc
gactcggaggatctgccaaaaacttgggactggagagacgctaatggcatcaactatgca
tctgctgaccgtaaccaacatattccacaatattgcggctcatgctgggcattcggagcc
accagcgcactagctgatcgtatcaatatcaagcgaaagaacgcgtggccacaagcctat
ctgtcagttcaagaagttatcgattgctccggtgcgggaacttgtgtgatgggcggagag
ccgggcggtgtctacaagtatgctcacgagcacggaattccacacgagacatgcaataac
taccaggcgagagacggaaaatgcgacccctacaaccgttgtggctcctgctggcccggc
gagtgcttctccatcaaaaactacaccctctacaaggtctccgagtacggaaccgtccat
ggctacgagaagatgaaggccgagatctaccacaagggaccaattgcctgcggaatcgct
gccaccaaagccttcgagacctatgcaggaggtatctacaaggaggtcactgatgaggat
atcgatcatattatttcggtgcatggatggggtgtagatcatgagtctggagttgaatat
tggattggaagaaactcgtggggagagccatggggagagcacggatggttcaagattgtt
acctcgcagtataagaatgctggaagcaagtataacttgaagattgaggaggattgtgtt
tgggctgatccgattgtttaa

DBGET integrated database retrieval system