KEGG   Caenorhabditis elegans (nematode): CELE_F32H2.5Help
Entry
CELE_F32H2.5      CDS       T00019                                 

Gene name
fasn-1
Definition
(RefSeq) Fatty Acid SyNthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00061  Fatty acid biosynthesis
cel01100  Metabolic pathways
cel01212  Fatty acid metabolism
Module
cel_M00082  Fatty acid biosynthesis, initiation
cel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CELE_F32H2.5 (fasn-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cel01004]
    CELE_F32H2.5 (fasn-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F32H2.5 (fasn-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase
     CELE_F32H2.5 (fasn-1)
Lipid biosynthesis proteins [BR:cel01004]
 Fatty acid synthase
  Animal type
   CELE_F32H2.5 (fasn-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F32H2.5 (fasn-1)
  Exosomal proteins of breast milk
   CELE_F32H2.5 (fasn-1)
  Exosomal proteins of colorectal cancer cells
   CELE_F32H2.5 (fasn-1)
  Exosomal proteins of bladder cancer cells
   CELE_F32H2.5 (fasn-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C KAsynt_C_assoc ADH_zinc_N ADH_zinc_N_2 Thioesterase PS-DH adh_short PP-binding Thiolase_N ACP_syn_III Abhydrolase_1 YjeF_N
Motif
Other DBs
NCBI-GeneID: 172715
NCBI-ProteinID: NP_492417
WormBase: WBGene00009342
Ensembl: WBGene00009342
UniProt: P91871
Position
I:complement(join(8975957..8976049,8976128..8976248,8976298..8976560,8976611..8981046,8981102..8982651,8982708..8983215,8983270..8983501,8983594..8983844,8984118..8984353,8984701..8984783,8986454..8986522))
Genome map
AA seq 2613 aa AA seqDB search
MDNTGEGSSDSSGTWERISDNSQSSDNMDPTQWWQKQDDIVISGVSGRFPRCDNVKMFGD
MLLAGEDLVTEDSLRWTPGFCDLPKRHGKLKVLNKFDAGFFQVTPKQANFMDPQVRLLLE
ASWEAMVDAGINPTDLRGSKTGVFVGCSASETSGMLTQDPDTVTGYTLTGCVRSMFSNRI
SYTFDLQGPSFSVDTACSSSLLALQLAVDSIRQGQCDAAIVAGAHLTLTPTAALQFLRLG
MLTDKGSCRSFDESGDGYCRTEGVAAIFIQRKKKAQRLYATVVHAKSNTDGHKEHGITFP
SGERQAQLLQEVYSEAGIDPNSVYYVEAHGTGTKVGDPQEANAICEVFCSKRTDSLLIGS
VKSNMGHAEPASGVCSLTKILLSIERQLIPPNLHYNTPNQYIPGLTDGRLKVVTEPTALP
GGLIGINSFGFGGSNTHVILKAADHIAPPITPHPFTKLVTYCGRTQEAVENIFTEIESNK
DDLYLQALLANQANMPANLLPFRGYMLLDRENNVETLKSITKVPITEARPIYFIYSGMGS
QWPGMAIKLMKIPMFDDSLRASSKTLEEFGLDVYGMLCNPDPEQYSNNTMNCMLAITAIQ
IALTDVLTALGVSPDGIIGHSTGEMGCGYADGGITREQTMRLAYHRGTTIMKHTEIKGAM
AAVGLTWEQVKEQAPPGVVAACHNGADSVTISGDAEGVATFCAQLKEKDIFAKVVDTSGI
PFHSPAMLAVQDEMIECMRTAVPEPKPRSSKWISTSIPEDDWESDLAATCSAEYHVHNAC
SPVLFYEAIQKIPANAVTIEMAPHSLMQAILRRSLQKTVTNVGLMNRPKSENDDELESFL
GSLGKIYQAGVNIQITELYPGGQYKGVVPKGTPMIGPMWKWDHTQDWLTIDGRQVLAGGS
GSVASSATYNIDPFATDSKETYLLDHVIDGRVLYPFTGHMVLAWRTLCKLKGLDYTKTPV
VFENINVFSATILTKPIKLDVVLSPGNGYFEIISDDQVAASGRIYIPEDNQPFYYGKLED
IRTSEIADRIELDTEDAYKEFLLRGYEYGQAFRGIYKTCNSGERGFLYWTGNWVTFLDSL
LQTALLAERSDTLRLPTRVRHLRIDPNKHLEHVVEKDGIQVIELRNDHSTNGCIAGGVEC
CDLNAHSVARRIQVSGQLYHEKIFFVPHFDHNCLSGHKKTSTILKDYSAVIKQQLYTGFS
KWQSAGLLKKLKNGAQIVKALAVLKASQSDVVLDDTVTRFTHDGKCTVLHHIADMFKIED
CEDFEDRVAAKLKSVRGIFELDRLWAGAVLNDRIVKSLQDICIENSAGHHATMAAVDLVS
TDQIRHCIEANSSHPLLETDYTCIGANVDHLDESTLEIIGGKKQKIDLENNFTGHGEVKN
LDYVLLDKVISKKADPIAFIEACKHLIRETGFLLVVEVTSQYEIALAIEGLLGNEMVGDA
SRKYNQFFTHEQLLDMFKSTGFLICNFQSDPALMTTTYAVRRVSPIPRDPVFIDVDDVKE
FNWIEPLQKVSEERLNEPDSKTIWLVSNKCRNNGIVGLGLCFVEENLKINRFRSAFDMSA
NKEIRDGPPVWNIGDEETKKIVELDLHANDYMDGQWGSMRHIVVKDEDVHVYKDCEHAFI
NTLTRGDVSSLTWFESPNQYFDSMVKSKATQELCSVYYAPINFRDIMLAYGRLPPDAIPG
NFADRECLLGMEFSGRLKDGTRLMGILPAQALATTVMVDRDYAWEVPRDWTLAEASTVPV
VYTTAYYALVRRGLMKKGDKILIHGGAGGVGQAAIAIALAAGCEVFTTVGSAEKREFLKN
LFPQLQEHHFANSRSADFELHIRQHTKGRGVNIVLNSLANEMLQASLRCLARHGRFLEIG
KVDLSQNSSLGMAKLLDNVSVHGILLDSIMDPTVGDLDEWKEIARLLEQGIKSGVVKPLH
SHSFPADKAEEAFRFMSAGKHIGKVIMEIRPDEGTKVCPPSKISVRAICRTLCHPQHTYL
ITGGLGGFGLELAQWLINRGARKLVLTSRTGIRTGYQARCVHFWRRTGVSVLVSTLNIAK
KSDAVELINQCTAMGPIGGIFHLAMVLRDCLFENQNVQNFKDAAEAKYYGTINLDYASRE
HCDKNILKWFVVFSSITSGRGNAGQTNYGWSNSCMERMIDQRRADGFPGIAIQWGAIGDV
GVILENMGDNNTVVGGTLPQRMPSCLSSLDNFLSWNHPIVSSFIKAELGSKKNVGGGDLM
ATIAHILGVNDISQLNADANLSDLGLDSLMGVEIKQALERDHDIVLSMKEIRTLTLNKLQ
QLADQGGTGRTALQVNELEMKKDGERDAELNTAEMLEQQMNQLFKMRVDVNDLDPQDIIV
KANKVEEGPITFFVHSIEGIATPLKKVMNKCEFPAYCFQSTKNVPQTSIEDVAKCYIREM
KKIQPSGPYRLVGYSYGACIGFEMANMLQESDGRDAVERLILLDGSHLYMQTYRNVYRMA
FGVTGDSLVNNPLFESEIMCAMTLRFANVDYKKFRFELLQQPGFKARVQKVVDQVMLTGL
FKSPETVAFACEAMHSKFLMADKYKPRRNFGGHITLIRAEQGAAREEDVGEDYGVAAVSE
DCEVLKVKGDHDTFVQGKSSSVTVEHINRIILQ
NT seq 7842 nt NT seq  +upstreamnt  +downstreamnt
atggataatactggagaaggatcgtccgattcgagtggaacttgggagcgaatttcggac
aattctcagtcttcggacaacatggatccaacacaatggtggcagaagcaggacgatatc
gtaatctcaggagtctcgggccgatttccaagatgcgataacgtcaaaatgttcggagac
atgcttcttgctggtgaagacctggtaacggaagactctctcagatggacaccaggattt
tgcgatctgccaaaaagacatggaaaactgaaagtgttgaacaaattcgacgcgggcttt
tttcaagttactccaaaacaggcaaatttcatggatccacaagttcgactacttcttgaa
gcttcatgggaggcaatggttgatgcgggcataaatcccactgacctccgtggatccaaa
acaggagtttttgttggatgttcagcttcagaaacctctggaatgctcacacaagaccca
gatactgtaacgggctacacgttgacgggttgtgtgcgttctatgttctctaaccgtatt
tcttacacattcgatttgcaaggaccatctttctcggtggacaccgcttgctcatcttca
cttttggcacttcaacttgccgtcgactctattagacagggtcaatgcgacgccgctatt
gtcgcaggagctcatctcacattgactccaactgcagctctccaattcttgagattgggc
atgctcacagataagggaagctgccgttcattcgacgaatctggtgatggatattgtcgt
actgaaggagttgcagccatcttcattcaacgcaagaagaaggctcaaagactctatgca
actgttgttcacgccaagtctaacactgatgggcacaaggagcatggaatcactttccca
tcaggagaaagacaagctcaattgcttcaagaagtttattctgaggctggaatcgatcca
aactcagtctactacgttgaggctcacggaactggaactaaggtcggagatccacaggaa
gccaacgcaatctgtgaagttttctgctccaagcgtactgattctcttttaatcggttca
gtcaaatctaacatgggacatgctgagccagcatctggagtttgctctttgaccaagatt
cttctctccattgaacgtcaattgattccaccaaatttgcattacaatactccaaatcag
tacattccgggacttaccgacgggcgcttgaaggttgtcacggagccaactgcacttcca
ggaggacttattggaatcaactctttcggattcggaggatctaacactcacgtcatcttg
aaggctgctgatcatatagctccaccaatcaccccacatccattcaccaaacttgtcact
tactgtggaagaactcaagaagctgttgaaaacattttcaccgaaattgagagtaacaag
gatgatctctaccttcaagctttgttggccaatcaggctaacatgccagccaaccttctt
ccattccgtggatacatgcttttggatagagaaaataatgttgagaccttgaagagcatc
accaaggtcccaattactgaagctcgtccgatctatttcatttactctggaatgggatcc
caatggcctggaatggcgatcaagctcatgaagattccaatgttcgatgattctcttcgt
gcttccagcaagacccttgaagaatttggacttgatgtttacggaatgctctgcaatcca
gatccagaacaatactccaacaacactatgaactgcatgctcgccatcactgctatccaa
atcgctttgactgatgttctcactgctctcggagtttcaccagatggaataattggtcat
tcaactggagaaatgggatgtggatatgctgacggaggaattactcgtgagcaaacaatg
agacttgcttatcatcgtggaaccaccatcatgaagcacactgaaattaagggtgctatg
gctgctgttggtttgacttgggagcaggttaaggaacaagctccacctggagttgttgcc
gcttgccacaacggagctgactcggttaccatttctggagatgctgaaggtgtagctaca
ttctgtgctcaactcaaggagaaggatatctttgcgaaggttgttgatacatctggaatt
ccattccactccccagcaatgctagctgttcaagacgagatgattgagtgcatgagaact
gctgttccagaaccaaaaccaagatcttcaaagtggatttctacatccatcccagaagat
gactgggagtctgacttggctgcaacttgctctgctgaataccatgtccacaatgcttgc
tctccagtgttgttctacgaagctattcaaaagattccagcaaacgctgtcaccattgaa
atggctccacattcattgatgcaagccattcttcgtcgttcacttcaaaagactgtcacc
aacgttggtcttatgaacaggccaaagtctgagaatgatgatgaactcgagagcttcttg
ggatctcttggaaagatctaccaagcgggagtaaacattcaaatcactgaactctaccca
ggaggtcaatacaagggagttgttccaaagggaactccaatgattggtccaatgtggaaa
tgggaccacactcaagactggcttaccattgatgggcgtcaagttcttgctggaggaagt
ggatctgttgcatcatctgctacctacaacattgatccatttgcaactgattccaaggaa
acctatcttcttgatcacgtcattgatggccgtgtactctacccattcactggacatatg
gtacttgcttggagaactctttgcaaactcaagggattggattacactaagactccagtc
gtctttgagaacatcaatgtcttctctgccaccatccttaccaagccaatcaaattggat
gttgtcttgtccccaggaaatggatactttgagattatctctgatgatcaagttgctgct
tctggaagaatctacattccagaagacaaccaaccattctactacggaaaattggaagat
attcgtacatctgaaattgctgatcgtattgaactggacactgaggatgcctacaaggag
ttccttcttagaggatatgaatatggacaggctttccgtggaatttacaagacatgcaac
tctggagaacgcggattcttgtactggaccggaaactgggtcactttcttggactccctt
cttcaaactgctcttcttgccgagcgatctgacactcttcgtcttccaactcgcgttcgt
catcttcgtattgatccaaacaagcatcttgagcatgttgtcgaaaaagacggaatccaa
gttattgaattgagaaacgatcattctaccaatggatgtattgctggaggagttgaatgc
tgcgatttgaacgctcattcagtcgccagaagaattcaagtttctggacaactctaccat
gagaagatctttttcgttcctcactttgaccataactgtctcagtggacataagaaaact
tctacaattctcaaggactactctgctgttatcaagcaacaactctacactggattctcc
aaatggcaatccgctggactcctgaagaagttgaagaacggagctcaaattgtaaaagct
cttgctgttctcaaggcttctcaatctgatgttgttcttgatgatactgtcacaagattc
actcatgatggaaagtgcactgtgctccatcacatcgctgatatgtttaagattgaagat
tgcgaggactttgaagatcgtgttgctgctaagctgaaaagtgttcgcggtatcttcgaa
ctggataggctctgggctggagctgttctcaatgatcgcattgtcaagagtcttcaagat
atttgtattgaaaactctgctgggcatcatgcaacaatggcagcggttgatttggtctct
actgatcaaattcgtcattgcattgaagccaactcatctcatccacttcttgaaaccgat
tatacttgcatcggagccaatgttgatcatttggacgaaagtacgctcgagattattgga
ggaaagaagcaaaagatcgacttggagaataatttcactggacatggagaagtcaagaat
ttggattatgttcttttggacaaagttatcagcaagaaggctgatccaattgcctttatt
gaagcttgcaagcatttgatccgcgagactggattcttgttggttgttgaagttacctct
caatacgaaattgctcttgccattgaaggacttcttggaaatgaaatggttggagatgct
tctcgtaagtacaatcaattctttactcacgaacaacttctcgatatgttcaaatccact
ggattccttatttgcaacttccaatcggacccagcccttatgaccactacatatgccgtt
cgtcgtgtttcaccaatcccacgtgatccagtctttattgacgttgatgatgtcaaggag
ttcaactggattgagcctcttcaaaaggtctctgaggaaagactcaacgaaccagattcc
aagaccatctggctagtgagtaacaaatgccgaaataatggaatagttggacttgggctt
tgcttcgtcgaggagaatttgaagattaacagattccgttctgcttttgatatgtctgcc
aacaaggaaattcgtgatggaccgccagtctggaatattggtgatgaggagaccaagaag
atcgttgagcttgatcttcacgccaatgactacatggatggacaatggggatcaatgcgt
catatcgttgttaaggatgaagatgttcatgtctacaaagattgtgagcacgctttcatc
aacactcttacacgtggagatgtttcatctcttacctggttcgagtctccaaatcaatat
tttgattccatggttaagagcaaggctactcaagaactgtgctctgtatattatgctcca
atcaacttccgtgatattatgcttgcttacggacgtcttccaccagatgctattccagga
aactttgctgatcgtgaatgtcttctcggaatggagttctctggacgtctcaaggatggt
acccgtttaatgggaattcttccagctcaagctcttgccaccactgtcatggttgataga
gactacgcttgggaagttccaagggattggactcttgctgaagcttcaactgtcccagtt
gtctacaccaccgcttattatgctttggttagaagaggattaatgaagaagggagacaag
attctcatccacggaggagctggaggagtcggacaagctgccattgccatcgctcttgct
gctggatgtgaagtcttcaccactgtcggatcagctgagaaacgtgaattcttgaagaac
ttgttcccacaacttcaagagcatcacttcgctaactctcgttccgctgacttcgaactt
catatccgtcaacacaccaaaggacgtggagtcaacattgttctcaactcacttgccaac
gagatgcttcaagcttctctcagatgtttggctcgtcacggacgtttccttgaaatagga
aaggtcgacttgtctcaaaactcatcccttggaatggctaagcttttggataacgtttcc
gttcacggaatccttcttgattctatcatggacccaaccgttggagatttggatgaatgg
aaagagattgccagacttttggaacaaggaatcaagagcggagttgtcaagccacttcac
tcgcattccttcccagctgacaaggctgaggaagcattccgtttcatgtctgctggaaaa
cacattggaaaggtcatcatggagatccgtccagatgaaggaaccaaggtatgcccacca
tccaagatctcagttcgtgccatctgtcgtactctctgccatccacaacacacgtacttg
atcaccggaggactcggaggattcggtcttgaattagctcaatggctcatcaaccgtgga
gcacgcaaacttgttcttacctcgagaactggaattcgtactggataccaagcaagatgt
gttcatttctggagaagaactggagtttccgttcttgtatccactttgaacattgctaag
aaatcggacgctgtagaactcatcaaccaatgtaccgccatgggaccgattggaggaata
ttccatttggctatggttcttcgtgattgtctgttcgagaaccaaaacgtgcagaacttc
aaggatgccgccgaggccaagtactatggaaccattaatttggattatgcttctcgtgaa
cattgtgacaagaacatcttgaaatggttcgtcgtcttctcgtctattacttctggacgt
ggaaatgctggacaaacgaactacggatggtccaactcttgtatggagagaatgattgat
caacgtcgtgccgatggattcccaggaattgcaattcaatggggagctattggagatgtc
ggtgtcattcttgagaacatgggagataacaacaccgttgttggtggaactcttccacaa
agaatgccatcttgcttgtcttctcttgacaacttcttgtcttggaatcatcctattgtt
tcctccttcatcaaggctgagctcggatcaaagaagaatgttggaggtggagacttgatg
gcaactattgctcatattcttggagtcaatgacatttctcaattgaatgctgatgccaat
cttagtgatttgggacttgattccttgatgggagtcgaaatcaagcaagctcttgagaga
gatcacgatattgttctttccatgaaagaaatccgtactctgaccctcaacaagcttcaa
caacttgctgatcaaggtggaactggtagaactgctcttcaagtcaacgaattggagatg
aagaaggatggagaacgtgatgccgagttgaatactgctgagatgcttgagcagcaaatg
aaccagttgtttaagatgagagttgatgtcaatgatttggacccacaggatatcatcgtt
aaggctaacaaggttgaagaaggaccaatcactttcttcgttcactcgattgagggaatt
gcaactccactcaagaaggttatgaacaaatgtgaattcccagcttactgcttccaatca
accaagaacgtccctcaaacttccatcgaggatgttgccaagtgctacattcgtgaaatg
aagaagattcaaccatctggaccatatcgtcttgttggatattcttacggagcttgcatt
ggatttgaaatggccaatatgcttcaagagtccgacggaagagatgctgttgaacgattg
attcttctcgatggatcccatctctacatgcaaacttacagaaacgtataccgtatggcc
tttggagtaacgggagattccctggtcaacaatccactcttcgaatctgagatcatgtgt
gccatgactcttcgtttcgccaatgtggattacaagaagttccgatttgaactccttcaa
caaccaggattcaaggcccgtgtgcaaaaggtggtggatcaagtcatgctaactggtctc
ttcaagtcaccagagaccgttgcatttgcctgtgaggcaatgcattccaagttcctcatg
gctgacaagtacaagccaagaagaaacttcggtggacacatcacactgatcagagctgag
caaggagctgctcgtgaggaggacgttggagaagattatggagttgcggccgtgtcagaa
gattgcgaggtgctcaaagttaaaggagatcacgataccttcgtgcaaggaaagtcatct
tcagtaacagttgaacacatcaacaggattattcttcaataa

DBGET integrated database retrieval system