KEGG   Caenorhabditis elegans (nematode): CELE_F33G12.2Help
Entry
CELE_F33G12.2     CDS       T00019                                 

Gene name
F33G12.2
Definition
(RefSeq) Uncharacterized protein
  KO
K13124  mitogen-activated protein kinase organizer 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cel03041]
    CELE_F33G12.2 (F33G12.2)
Spliceosome [BR:cel03041]
 Complex C
  Other components
   Complex C specific factors
    CELE_F33G12.2 (F33G12.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like PQQ_2
Motif
Other DBs
NCBI-GeneID: 173867
NCBI-ProteinID: NP_494926
WormBase: WBGene00018014
Ensembl: WBGene00018014
UniProt: Q19986
Position
II:complement(join(5029998..5030154,5030197..5030301,5030358..5030488,5030542..5030765,5031362..5031586,5031633..5031708))
Genome map
AA seq 305 aa AA seqDB search
MSKCPTVRARAIDCKQGAVRAVRYNVDGNYCVTCGSDKTVKLWNPLKSSLLKTYSGTGNE
VLDAASSSDNSQIAAGGADRACTVFDVETGKQLRRWRTHGAQVNAVAFNEESSVVFSGSM
DCTMQAFDCRSRSEKPIQIFNESTDGILSIDVNGHEIVAGSADGNYRVYSIRDGNMTVDY
MGDSVNSVSFTPDSNCLLAGVMGGIVRLIDKSSGKLLASYKGHQNTEYKLDCRVLQSIEH
VASGSEDGFVYVYSLLDSHIVSKLEHPSKVIHSLTAHPKKERLMTAAGQMIYLWVAEDDA
EVLGE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatgcccaacggttcgtgcaagagcaattgattgtaagcaaggtgcagtacgt
gcggttcgatataatgtcgatggaaattactgtgtaacatgtggaagtgacaaaactgtc
aaattatggaatccattgaagagcagtcttcttaaaacatattctggaactggaaatgag
gttcttgacgccgcttcatcatcagacaattcacagatagctgctggtggagccgataga
gcctgtacagtatttgatgtagaaactggaaaacaattgagacggtggagaacacatgga
gcacaagtgaatgcagtggcatttaacgaagaatcatctgtggtattctccggctcaatg
gactgtacaatgcaggcatttgactgcagatctcgaagtgaaaaacctattcaaatattc
aatgaatcaactgatggaattctctcaattgatgttaatggccatgagattgttgctgga
agtgctgatggaaattacagagtctatagtattagagatggaaatatgacagtcgactac
atgggagattcagtaaacagtgtcagctttaccccagacagtaattgcctgttggctgga
gtaatgggtggaattgttcggcttattgataaatctagtggaaaattgctagcaagctat
aaaggtcatcaaaacacggaatacaaattagactgccgagttttacaatccatcgagcac
gtggcaagtggctcagaagacggattcgtttatgtgtatagtctcctcgattcacacatc
gtgtcgaaactcgaacatccttcaaaagtgattcattctctgacggctcatccgaaaaaa
gaacgactcatgactgcagcaggacaaatgatttacttatgggttgccgaagatgatgcg
gaagtgctcggagaataa

DBGET integrated database retrieval system