KEGG   Caenorhabditis elegans (nematode): CELE_F37A4.8
Entry
CELE_F37A4.8      CDS       T00019                                 

Gene name
isw-1
Definition
(RefSeq) Chromatin-remodeling complex ATPase chain isw-1
  KO
K11654  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 [EC:3.6.4.-]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cel03021]
    CELE_F37A4.8 (isw-1)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_F37A4.8 (isw-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CELE_F37A4.8 (isw-1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase I system
   Other transcription-related factors
    NoRC (nucleolar remodeling complex)
     CELE_F37A4.8 (isw-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    CELE_F37A4.8 (isw-1)
   RSF complex
    CELE_F37A4.8 (isw-1)
   WICH complex
    CELE_F37A4.8 (isw-1)
   B-WICH complex
    CELE_F37A4.8 (isw-1)
   NuRF complex (fruit fly)
    CELE_F37A4.8 (isw-1)
SSDB
Motif
Pfam: SNF2_N SLIDE HAND Helicase_C ResIII DEAD Myb_DNA-binding TniB AT_hook
Other DBs
NCBI-GeneID: 175944
NCBI-ProteinID: NP_498468
WormBase: WBGene00002169
Ensembl: WBGene00002169
UniProt: P41877
Position
III:complement(join(6704216..6704392,6704440..6704856,6704909..6705082,6707355..6707525,6707573..6708649,6708702..6709058,6709108..6709287,6709336..6709414,6709459..6709648,6709698..6709836,6709932..6710000))
AA seq 1009 aa
MSVHESSNEINDEPMDTDSNIPESSGNDPSMEVDDEPESSDAADSFKRFERLLQKTENFS
HCLSSGDAKLATGAPVDTKKRGRPSKKNGIDGDHRHRKTEQEEDEEMVADAIKSDDLVIF
DKSPFYIENGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNK
ASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYE
MMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELW
ALLNFLLPDIFTSSDDFDSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKK
EVKVYVGLSKMQREWYTKVLMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYLFDGAEP
GPPFTTDQHLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCR
LDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQ
AMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKTLGKGD
MISMIRHGAEQVFAAKDSTISDDDIDTILEKAEVKTAELNEKMGKIDENNLRNMTFEDNA
KFTVYQFEGENYKAKQADGMGHFWIEPPKRERKANYQVDLYYKEAMRAGNPTEKQSKAPR
PKLPQVFDFQFYPRRLFELLDKEIYHYRKTIGYVAERPKDVPPKEAEKRQAEEQKLINNA
RPLTDKEQEEKAELLTQSVTDWTKREFQQFVRGNEKYGREDLESIAKEMERPLEEIQSYA
KVFWERIEELQDSEKVLSQIEKGEARIQRKYAVKKALDAKIAKYKAPFQQLRISYGTNKG
KTYTEEEDRFLVCETHRLGHDKENVFEELRQSVRMAPQFRFDWFLKSRTAMELQRRCNTL
ITLIEREMGEVVESKPVIVTAADKKKSVAKDLSKSSGTPTAKKVKATPK
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtcggttcacgagtcttcgaacgaaataaatgacgagcctatggacaccgattccaac
atcccggagtcttccgggaacgatccctcaatggaagtggacgatgaaccggaatcgtcc
gacgccgccgattccttcaagagatttgaaagattgttacaaaaaacggaaaacttctca
cattgtttatcatctggagatgcgaaattagcaactggagccccagttgacaccaaaaag
cgtggacgcccctcgaagaaaaacggaatagacggagatcatcgacacagaaaaactgag
caagaagaagatgaagaaatggtggccgatgctattaaaagtgatgatttggtgattttc
gacaaaagtccgttttacatcgagaatggagaaatgagagattaccaagttcgtggactc
aactggctcgcatcccttcaacataataaaatcaatggaattttagctgacgaaatggga
ctcggaaaaacactccaaacgatttctatgataggatacatgaaacattacaaaaacaag
gcgtctccacatcttgtcattgttccaaaatccactcttcagaactgggctaacgagttc
aaaaagtggtgcccatcgattaatgcggttgttctgattggagatgaagcagcgagaaat
caagttctgcgcgatgttattcttccacaaaaattcgatgtttgctgcacaacctatgaa
atgatgctgaaggtcaaaactcaattgaaaaagttgaattggagatatatcattattgat
gaagcacatcgtatcaagaatgagaaaagcaaactttctgaaacagttcgagaactcaac
tctgagaatcgattgttgataacaggaactccactgcagaacaacttgcacgagctgtgg
gctcttttgaatttcttgctgcctgacattttcacctcttctgatgattttgattcctgg
ttttctaatgatgcaatgagcggaaatactgatctggtgcaacggcttcataaggttctt
caaccattccttcttcgtcgtatcaagtctgatgttgagaaatctttgttaccaaagaaa
gaagtgaaagtgtatgttggattatcgaaaatgcaaagagaatggtacacgaaggttctc
atgaaagatatcgatattatcaatggagccggtaaagtcgagaaggctaggcttatgaat
attcttatgcatctccgaaaatgtgtcaaccatccttatctcttcgacggtgctgaaccg
ggaccacccttcaccacagatcaacatcttgtcgataattctggaaagatggttgttctc
gataaattgctaatgaagtttaaagaacaaggatctcgagttcttatcttctctcagttc
tcccgaatgctcgatttacttgaagatttttgctggtggcgtcattatgagtactgccgt
ctggatggatcaactcctcacgaggatcgatctaacgcaattgaggcatacaacgctcca
gactcgaaaaagttcattttcatgcttactactcgcgctggaggtcttggaatcaacttg
gctaccgctgacgttgtgatcatctacgactctgattggaatccacaatcagatcttcag
gcaatggacagagctcatcgtatcggtcaaaagaaacaagttcgtgtgttccgactgatc
acagagaatacagtcgatgaaagaattatcgaaaaggctgaagccaagcttcgccttgac
aatatagttattcaacaaggtcgtatgtcggaagcccagaaaactcttggaaagggtgat
atgatcagcatgatcagacacggagccgaacaagtctttgctgccaaggattcaacaatt
agtgatgacgatattgatacaattcttgaaaaagctgaagtaaagactgctgaattgaat
gagaaaatgggcaagattgatgagaacaatcttcgtaacatgacgttcgaggataacgct
aaattcacagtatatcagttcgaaggtgaaaattataaagcaaagcaagccgacggaatg
ggtcatttctggattgaaccaccaaagagagaacgaaaggccaattatcaggtagatctt
tactacaaggaagcaatgcgagctggaaatccaactgaaaaacaatccaaggcgcctcgt
ccgaagctcccacaagtttttgatttccaattctatcctcgtcgtctatttgaacttttg
gacaaagagatttatcattatcgcaagacaatcggatatgtggctgaaagaccgaaggat
gttccaccgaaagaggctgaaaaacgacaggccgaggagcagaaactgataaacaatgct
cgaccattgactgacaaggaacaagaagaaaaagctgagcttttgactcagtctgtcaca
gactggacaaaacgcgagttccaacagtttgttagaggaaatgaaaagtatggtcgtgaa
gatttggagagtatcgcgaaggaaatggaacgtccacttgaagagattcaatcttacgct
aaagttttctgggaacgtatcgaagagcttcaggactctgaaaaagtgctcagtcaaatt
gagaagggcgaggcacgaattcaacgaaaatatgctgtgaagaaggcgcttgacgctaaa
atagcaaagtacaaggctccgtttcaacagttgcgtatttcctatggtacaaataaagga
aaaacgtacaccgaagaagaggatcgattcctggtttgtgagactcatcgattgggacat
gataaggaaaatgtgttcgaagagctgcgtcagtctgttcgcatggcaccacaattcaga
tttgattggttcctgaagagtcgtacagcaatggagcttcaacgccgttgcaatactctt
attactttgatagaacgtgaaatgggagaagttgtggagtcaaagcctgtcatcgtgacc
gctgccgataagaagaaatctgtcgctaaggacctgtcaaagagtagtggaactccaact
gctaagaaagtcaaagctactcctaaataa

DBGET integrated database retrieval system