KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.4Help
Entry
CELE_F42G8.4      CDS       T00019                                 

Gene name
pmk-3
Definition
(RefSeq) Mitogen-activated protein kinase pmk-3
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04212  Longevity regulating pathway - worm
cel04361  Axon regeneration
cel04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G8.4 (pmk-3)
   04068 FoxO signaling pathway
    CELE_F42G8.4 (pmk-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F42G8.4 (pmk-3)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F42G8.4 (pmk-3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    CELE_F42G8.4 (pmk-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F42G8.4 (pmk-3)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F42G8.4 (pmk-3)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_F42G8.4 (pmk-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like RIO1 Pox_ser-thr_kin Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 177610
NCBI-ProteinID: NP_501363
WormBase: WBGene00004057
Ensembl: WBGene00004057
UniProt: O44514
Position
IV:join(8140246..8140497,8140981..8141126,8141177..8141261,8141560..8141669,8141715..8141862,8142036..8142642,8142724..8142800)
Genome map
AA seq 474 aa AA seqDB search
MASVPSSSSLPVSHVRRHEDVSTPSAPPTKRSNNQSQPPESYEPNTWLQQQREQEQQKKL
AAENIKKQSIEATGNNEMVGEEEEDILSKPCGPHKRRFQFVMIRNITFAIPEGYDVEPNS
IEYLGGGSFGNVIKTSAVCRDGLRRYVAIKKMREPFFDPHHARRIFRETKLLQLMRHDNI
ICALDIYTPDEENDFRDVYVVTEFAGRSLYQILKQQRDYGRRVLTDEHIKFIIYQIIRAL
KYIHSANIIHRDLKPGNLALTDDSDLMILDFGLARSLEKKDTSLTQYVQTRWYRSPEVIY
WKIDSYTNLADMWSLGCIAAELLTGEPLFPGDEPNAQYQRITQLCGSPDEELLTKIENDN
SSAIKAVIQSYTTHKRRNFRDVFSAHNPSEDFIDLLEKLLVLDPEKRITVEEAIQHPYLA
EFSLPEDEPRADHIFDLDDSQARTRFEWRDAVWKEIMNYKRLSSSPLIPGEADR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagtcccatcgtcatctagtctcccagtgtcgcatgtccgtcgtcatgaagac
gtgtcaacaccaagtgcaccaccaaccaaacgaagtaataatcaatctcaacctccagaa
agctacgaacccaacacctggttgcaacaacaacgagagcaggaacaacagaaaaagtta
gctgcagagaatattaagaagcagagtatcgaagcaacgggaaacaacgagatggttggg
gaggaggaagaggatattctctcaaaaccatgtggtccacacaaacgacgattccaattt
gtgatgatccgtaacattacatttgcaattccggaaggctatgacgtcgagccaaacagc
attgagtatttgggtggaggctcgtttggaaatgttataaaaacaagtgcagtgtgccgt
gacgggcttcgtcgttatgttgcaataaagaagatgcgagaaccgttctttgatccacat
catgctcgtcgcatcttccgtgaaacaaaacttcttcaattaatgagacatgacaatatc
atctgtgctcttgacatctacacacctgacgaggaaaacgattttcgagatgtatacgtt
gtcactgaatttgcgggtcgtagtctttatcagatcttgaagcaacaaagagattatgga
cggcgcgtgctgaccgacgagcatatcaaattcatcatttatcaaatcatacgtgcactt
aagtacattcattctgctaatattatacatcgtgacttgaaaccaggaaatctcgcgttg
accgatgattctgacctcatgattctcgattttggacttgcaagatccttggaaaagaaa
gatacttctctaacacaatatgtacaaacaagatggtaccgtagtccagaagtcatttat
tggaagattgatagttacacaaatctggcagatatgtggtcacttggatgtattgctgca
gaacttttaactggagaaccactgtttccgggtgatgagcccaatgctcaatatcaacgt
attactcaattatgtggaagtcctgatgaagaacttttgacaaagattgaaaatgataac
tcgtctgcaattaaagccgtaattcaatcctacacaactcacaaacgtcgaaatttccgt
gatgtattttctgctcataatccatcagaagactttattgatctacttgagaagctttta
gttttggatccagagaagaggattacggtggaagaagctattcaacatccatatttggca
gagttttcacttccagaagatgaaccaagagctgatcatatatttgacttggatgactct
caagctagaacaagattcgagtggagagatgccgtctggaaggaaataatgaactacaaa
agactcagctcatcaccgttaatccctggagaagcagatcgctga

DBGET integrated database retrieval system