KEGG   Caenorhabditis elegans (nematode): CELE_F44B9.4Help
Entry
CELE_F44B9.4      CDS       T00019                                 

Gene name
cit-1.1
Definition
(RefSeq) Cyclin-T1.1
  KO
K15188  cyclin T
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cel03021]
    CELE_F44B9.4 (cit-1.1)
Transcription machinery [BR:cel03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     CELE_F44B9.4 (cit-1.1)
    Brd4/P-TEFb complex
     CELE_F44B9.4 (cit-1.1)
    7SK RNP complex
     CELE_F44B9.4 (cit-1.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclin_N FAST_2
Motif
Other DBs
NCBI-GeneID: 176125
NCBI-ProteinID: NP_498744
WormBase: WBGene00000507
Ensembl: WBGene00000507
UniProt: P34425
Position
III:complement(join(8006483..8006588,8007044..8007262,8007633..8007716,8007791..8007903,8007953..8008002,8008062..8008127,8008512..8008599,8008699..8008789,8008839..8008890,8008941..8009006,8009049..8009109,8009238..8009357,8009407..8009488,8009544..8009674,8009725..8009802))
Genome map
AA seq 468 aa AA seqDB search
MSVSSRGAASPAHRTAPTKWLFTKEEMKKTASIQEGMSREEELASRQMAAAFIQEMIDGL
NNVKDPKMKIGHTGLCVAHTHMHRFYYLHSFKKYDYRDVGAACVFLAGKSQECPRKLSHV
ISVWRERKDRKQLTTETARNEAAQIIVLLESMILQTIAFDLNVHLPHIYVLDIMKKVDKK
EHYRPLTSCAYYFATDVIAVTDWSLRYSAASMSIVIIHLMAAYANVRIERLFADFINEDS
PWYAKFDETMTNEKLREMEVDFLVTYRNSCQFHHASKFNFREHRPMLENPDVRKLDRTRD
ARSHSPMVHHVPDSTVNVRPRAYVPRDELTVERLNKERGVEEERRKRERDRMAGKLDSST
SSEKRARIDPLANNFVSSSSSSNGKLAPPPIPPQLNFPPPPIVSSGYNHKNQINRKNHEN
NHTNSSVSPAFVPSARTFDVAPMLTPPTAPKLQSADNSDMDLEDGELE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgtcgagtcgaggcgcggcttccccagcacatcggaccgcgccaaccaaatgg
ctcttcaccaaagaggagatgaaaaagacagcgagcattcaagaaggaatgagcagagaa
gaagaactagcctcccgacaaatggccgccgcgttcatccaagaaatgatagatggattg
aacaatgttaaagatccaaaaatgaaaatcggtcacacgggtctttgcgttgcacataca
catatgcatcgcttttattatttgcatagcttcaaaaagtatgattatagagacgtaggt
gctgcttgtgtatttttagcgggtaaaagtcaggagtgtccaagaaaattatcacatgtg
atcagtgtatggcgggagcgaaaggatagaaaacaattgacgacggaaactgctaggaat
gaagcagcccaaattattgttcttctggagagcatgattctacagacaatcgcattcgat
ctcaacgttcatcttcctcatatttatgttctggatatcatgaaaaaagttgataaaaaa
gagcattatcgacctttgacatcttgcgcctactattttgccacagacgtaatagctgta
acagactggtcacttcgatattctgcagcgtcaatgtctattgtaattattcatttaatg
gcagcctatgccaatgtccggatagagcgattatttgccgatttcatcaatgaagattca
ccgtggtatgcgaaatttgacgaaacaatgacgaacgagaagctgagagaaatggaagta
gatttccttgtaacatatcggaattcctgtcaatttcaccatgcttccaaattcaacttc
cgtgaacatcgtcctatgctggagaatccagacgtacggaaattagatcgtacgagagat
gccagaagtcatagtccaatggttcatcatgtacctgattctacagtaaatgtacgaccg
agagcatacgttccgagagatgaattgacagttgaaagattaaacaaagaacgaggtgtg
gaagaagaacgtcggaaacgagaacgagatcgaatggctggaaaacttgacagttcaacg
agtagtgaaaagcgtgctcgaatagatccacttgccaacaatttcgtatcttcatcatcg
tcatcaaatggaaaattggccccacctccaatacctccacagcttaattttccgccacca
ccaatcgtgtcatctggatataatcacaaaaatcagattaatcgaaagaatcatgagaat
aatcatacaaattcttcggtttcgccagcgtttgtgcccagtgctcgaacattcgacgtg
gctccaatgcttacaccaccaactgctccaaagctccaaagtgctgataattcagatatg
gatttggaagatggtgaactagaataa

DBGET integrated database retrieval system