KEGG   Caenorhabditis elegans (nematode): CELE_F45E6.2
Entry
CELE_F45E6.2      CDS       T00019                                 

Gene name
atf-6
Definition
(RefSeq) BZIP domain-containing protein
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_F45E6.2 (atf-6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_F45E6.2 (atf-6)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    CELE_F45E6.2 (atf-6)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf YabA
Other DBs
NCBI-GeneID: 181405
NCBI-ProteinID: NP_510094
WormBase: WBGene00000222
Ensembl: WBGene00000222
UniProt: Q20435
Position
X:join(12480948..12481040,12481097..12481288,12481581..12481856,12481905..12482075,12482126..12482302,12482351..12482590,12482637..12482722,12482772..12483002,12483235..12483451,12484186..12484272)
AA seq 589 aa
MNFDNTVHESNFDDLLHNPNFPPQFDQLELDSLLYGTDESQESTSSSSFGFSDQNAGFRS
RDGGSLGDSSSDSSPPLSCANFTENDQEMWDFGFQSRSPFENFEQQFGSPYQDDEVIAEP
TNEFMNARYLREEPAKHLPMQQKRIITILPKQSQPVKRIVSRPIQKVYRVKESPGSQQQT
YRVVQPLMPSPSQATQRQIKQMYYNEPVQEIHMQPKSGPLVRQVSEEPRYVPIAPTVDIK
AEPQVFTSEQNRKIRNRMYAQASRMRKKEADEHMKMNLQELLQENEILRTENAALKQRLA
FFEHEEPVVEVPQPFGRNQKKKRIIAAGSVLMMFGLFAVISPFNVDNNLNINNQIMAISN
ETSMVARHGRVITYEDSAPVAKIPTQQPIHNYPNSTQNDCDMYKLNATETIRVNNDIERW
VQVHSFDNVPMKFSGGLLNKEAMRKFNYAQKVKPASVYGPQTLAVQKKSEQAALRSRERT
WKQLDLLKTGNNIQLDNEKIQRKRQDIDKIASIVRQKGDTLYIMTLQDYVLLPSLIKGAN
SVPKLSLLLPSVPMNGTLQDQYTLLRVDCEVTGTGQLTLSNKQLSYLMP
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaactttgacaatacggttcatgaatcaaactttgatgatctcctgcataacccaaat
tttccgccgcaatttgaccagctagagttggacagcctactttacgggaccgacgaatca
caagaatcgacctcttcctcttcgtttggtttcagtgatcagaatgctggatttcgctca
agagacggcgggagtttaggagattcttcgtcggatagctctccaccgttgagttgtgca
aacttcacagaaaatgaccaggaaatgtgggattttggctttcaaagtcgcagtccattc
gagaattttgagcaacaatttggctctccatatcaggacgacgaagtgattgccgagccc
accaatgaattcatgaacgcaagatacctcagagaagaaccggccaagcatttgcccatg
caacaaaaacgaattatcacaattctccccaaacagtcacagcctgtgaaacgtattgtc
agcagaccaatccagaaagtataccgcgtcaaggaatcacccggcagtcagcaacaaaca
taccgagttgttcagcccttgatgccatctccttcacaagctacgcaacgccaaatcaag
caaatgtattacaatgagccggttcaagaaattcatatgcaaccaaaaagtggtccgctg
gttcgacaagtgtccgaagagccaagatacgttccaattgctccgacagtagatatcaaa
gcagaaccacaagtttttacttccgagcaaaatcgaaaaattcggaaccgaatgtacgcc
caagcctctcgcatgcgcaagaaggaagccgatgaacatatgaaaatgaaccttcaggaa
ctgcttcaagaaaacgagattctaagaactgagaatgccgctttgaagcaacgccttgcg
ttttttgaacacgaagagccagttgtcgaagttccacaaccctttggaagaaatcagaag
aaaaaaagaattattgctgctggttcagtactaatgatgttcggactttttgcagtcatc
tctccatttaatgtcgataacaatttgaatataaacaatcaaatcatggcaatttccaac
gaaacttctatggttgctcgccacggaagagtcatcacgtatgaagatagtgctcctgtt
gcaaaaattcctactcaacaaccaatccacaactatccgaactccactcaaaatgattgt
gatatgtacaaactaaacgccacagagacaataagagtaaacaacgacattgagcgctgg
gtacaagtacattcatttgataatgttccaatgaagttttcgggaggactattaaataag
gaagcaatgcgaaagttcaactacgcacagaaagtaaaaccagcctcagtttatggacca
cagacattggcggttcaaaagaaatcagagcaagcggcgctcagatctcgggaacgtaca
tggaagcagttggatctactgaagaccggaaacaatattcaactggataacgagaaaatt
caacgtaaacgacaagatattgacaaaatcgcttcaattgttcgccaaaagggagataca
ctgtacattatgacacttcaagactacgtgcttctgccttcattgattaaaggagcaaac
tcggttcccaaactatcgttgctcctgcctagtgttccaatgaatggaactctccaagat
cagtatactcttcttcgagttgattgtgaagtgacagggactggccaattgacactttcc
aacaagcaactttcatatttgatgccgtga

DBGET integrated database retrieval system