KEGG   Caenorhabditis elegans (nematode): CELE_F49E12.1
Entry
CELE_F49E12.1     CDS       T00019                                 

Gene name
skpo-1
Definition
(RefSeq) Peroxidase skpo-1
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: An_peroxidase ShK
Other DBs
NCBI-GeneID: 174340
NCBI-ProteinID: NP_495768
WormBase: WBGene00009897
Ensembl: WBGene00009897
UniProt: Q20616
Position
II:complement(join(8400410..8400512,8401060..8401268,8401316..8401381,8401430..8401487,8401987..8402112,8402225..8402410,8402639..8402803,8402848..8402972,8403021..8403083,8403126..8403234,8403280..8403383,8403582..8403691,8403899..8404132,8404184..8404331,8404375..8404487,8404796..8404844))
AA seq 655 aa
MKSLLFSILLIYLIQLVRSEECTDKHIHCFFWSQEGECEVNPRWMKKHCQKACGTCSLTS
PTPLTRQQDVPTARTFDDQQDRQFLPSRPSSIPEGCNSVMTVEAETRRIFSSGQLTARFR
QQMCAEEQVAPDCSINQCFHKKYRSMDGTCNNLQNPVKGAAFTAFTRLMPAAYDDGFNTL
VSASRRNRPNPREVSVFLLSSERSLPGHVNSLLMLFGQFVSHDITSNAAQNFCGCQNSGP
MCASIFAPPSDRSRRCIPFTRSFPICGTGQFGRVREQLNMNTAAIDASLIYGSEAITARS
LRFAAMLRTSMIGGRMFPPNTNPGSLTAGDGRAILFVGLAALHTSFLRLHNNVAARLQNM
NRHWNADRIFQESRKIVGGIVQVITYQEFVPELIGDASKTILGAYNGYNPNVEIGVLNEF
AAGAYRLHGMIQETYPLVNSQFQEVNRYRFIDGVNNINHVLNNIDAIYRGMMTVPVRSPQ
RLTTSVTERLFGGSVDMAAVNIQRGRDHGLRSYNDYRRFCNLRPITSFNDWPEVPDENVR
QRIGQLYRTPDDLDFYVGGILEQPAAGSLLGATFACVIGKQFERLRDGDRFYYENPGVFT
SPQLAELKRTTLSWVLCQTGDNMVRVGRRAFDIENGSRAVPCSSITGLNLEAWRE
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgaagtctctcctcttctccatattactcatatatttgatccagttagtacgatcggag
gaatgtaccgacaaacatattcactgcttcttttggtcacaagaaggagaatgtgaagtc
aatccaagatggatgaaaaaacattgtcagaaagcctgtgggacgtgttctttaacttca
cctactcctttaacccggcagcaggatgtaccaacggctagaacttttgatgaccaacaa
gatagacaatttcttccttcgagaccttcgtcaataccagaaggatgtaattcagtaatg
accgtcgaagccgagacccgtcgaatcttttcaagtggtcaattaaccgcccgtttccgg
caacaaatgtgcgcagaggaacaagttgctccagattgttccatcaatcagtgcttccat
aaaaagtatcgctcaatggacggcacgtgcaacaacttacaaaaccctgtcaaaggagcc
gcttttactgcattcactcgtcttatgccagctgcttatgatgatggttttaatactctt
gtgtctgcttcacgtcgtaatcgtccaaacccacgagaggtgtctgtattcctgttgtct
tcagaaaggtcactgcctggacatgttaattcacttcttatgcttttcggacagtttgta
tcccacgacattacttcaaacgccgctcaaaacttctgcggatgccaaaactccggacca
atgtgcgcttcgatttttgctccaccttctgacagatcacgccgttgcattccattcacc
cgatcattcccaatttgtggaactggacaattcggaagagttagagaacaactgaatatg
aatacagctgcaattgatgccagtttgatttatggatcagaagcaattactgctcgtagt
ttaagatttgcagccatgctcagaacatcaatgatcggaggtcgtatgtttccaccaaac
actaatcctggtagtttgactgctggagatggcagagcaattcttttcgttggacttgct
gcactccatacatcgttcctccgtctccataacaacgttgctgctcgtctccaaaatatg
aacaggcattggaatgcagatcgaattttccaggagtcaagaaaaattgttggaggaatt
gttcaagtgattacatatcaagaatttgttccagaacttattggagatgcttcgaaaact
attttaggagcatataatggatataatccaaatgtggaaattggggtattgaatgaattc
gcagctggagcttaccgtcttcatggaatgattcaagagacatacccattggttaactca
caatttcaagaagttaatagataccggtttattgatggagttaataatatcaatcatgtt
ttgaacaatattgatgcaatctacagaggaatgatgactgtaccagttagaagtccacag
agattgacaacttctgtgactgaaaggctctttggaggaagtgtcgatatggcagcagtt
aatattcaaagaggaagagatcatgggttgagatcttacaatgactatcgtcgattctgc
aatctccgaccaatcactagttttaatgattggccagaagttccagatgagaatgttcgc
caacgtattggacaactgtatcgtacaccagatgatcttgatttctatgttggaggaatt
cttgaacaaccagcagctggaagtcttttgggagctacgtttgcatgtgtaatcggaaaa
caatttgagagactccgtgatggagatagattctactatgagaacccaggagttttcaca
tcacctcaacttgctgagttgaagagaactactctttcatgggtattgtgtcaaactgga
gacaatatggtccgagttggtcgtcgtgcatttgacattgagaatggatcgagagcagtt
ccatgctcatcgattacaggattgaaccttgaagcctggagagaatag

DBGET integrated database retrieval system