KEGG   Caenorhabditis elegans (nematode): CELE_F52E1.1Help
Entry
CELE_F52E1.1      CDS       T00019                                 

Gene name
pos-1
Definition
(RefSeq) POsterior Segregation
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Motif
Other DBs
NCBI-GeneID: 179224
NCBI-ProteinID: NP_505172
WormBase: WBGene00004078
Ensembl: WBGene00004078
UniProt: G5EF15
Position
V:join(8414094..8414492,8414545..8414940)
Genome map
AA seq 264 aa AA seqDB search
MADNDFLSGEAIMVFKKEILDSHSDFTRSLSHQSASPEAYDQENVFSQDFQPFMKQDKET
QNSASQPTSEQSLANRDPCTVPDDLREEMMRQRRKEDAFKTALCDAYKRSQACSYGDQCR
FAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLASGA
HANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQSLPIRQSDLVRAFARATRLDVSGYN
STAQLAQYFESQFQRIQQLSSHHH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacgatttcctgagcggtgaagcaatcatggtgttcaaaaaggaaatcctt
gactcccacagcgattttactcgatcgctttcacatcagtcagcatcccccgaagcatat
gatcaagagaatgtattttctcaagacttccaaccgttcatgaaacaagataaggagacg
cagaattcggcttcacagccaacttctgaacaatcgttggccaatcgtgatccttgcaca
gttcccgatgaccttcgtgaagaaatgatgcgtcaaaggagaaaggaagatgcattcaag
acggctctgtgtgatgcttacaaacgcagtcaggcatgctcatacggtgatcagtgcaga
tttgctcacggcgtccatgagcttcggcttccaatgaaccctcgtgggagaaatcatccc
aagtacaagacggttctttgcgacaagttctcgatgactggaaactgcaaatacggaacc
agatgccagttcatccacaaaattgtcgatgggaatgccgcgaagctagcaagtggagct
cacgctaatacttcatccaaatcaccagcaaggaatgctgccgcacacaatcattcactc
ttcgtgcctcaggggtcgacagatcgaagcatggatctcaatcagagtctaccaatccgt
caatcagatctcgttcgtgcgtttgctcgtgccacccgtttggacgtatctggatacaat
tctacggctcaattggcacaatatttcgaaagccaattccagcggattcagcagctctcc
tcccatcatcactag

DBGET integrated database retrieval system