KEGG   Caenorhabditis elegans (nematode): CELE_F53B2.5Help
Entry
CELE_F53B2.5      CDS       T00019                                 

Gene name
F53B2.5
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arm NopRA1
Motif
Other DBs
NCBI-GeneID: 178204
NCBI-ProteinID: NP_502400
WormBase: WBGene00009956
Ensembl: WBGene00009956
UniProt: Q20703
Position
IV:complement(join(12528563..12528703,12528746..12528979,12529298..12529371,12529419..12529509,12529555..12529728,12529778..12530023,12530184..12530321,12530366..12530491,12530540..12530710,12531105..12531140))
Genome map
AA seq 476 aa AA seqDB search
MVKSTKKAKQEMNSQPEQSATFDISFIISMLESSCRIQLSTALHFFRKAFANQSDLSNIA
LKEQFYGRIKNGVLNALRNQTLDIDSEVNAVWIITNMCCISQEVTHLFVNSNCLDILIKL
VRSQNARLSSQTVWAIANIAADCSSCKLKCRSPKLLKILARNLQTSYKLDDADRRQLIWC
VNNIFSGGRTTMPSPVARSLICALSAILLDTDAVDNMGCGSMILWTLANLVDNSLDTTRI
DMLLSQNYVVEHILEKFIDQTDKSCNVSCLRLIGNIAVGNDVQTDLLVDNPKFRVVMNIA
MSSPEHHSEAAWIISNVVAGAPRHVDYIMDDPDAFYEWVMAGIHTGDKRLRKECLWIIGN
LLATADEHQTYLLVSLGIVQHFPALLDFDDVRLNEKAATTATELLREHPWQYTLFQRLDI
LGCIERAGANFSIQKAELKSLMNDLAPPERKDEDIAKGCSVICYSKLSDDFHSMSI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggttaaatctacaaagaaagcgaagcaggaaatgaattcccaacctgaacaatcagca
acatttgacatttcctttatcatctcaatgctcgaatcctcatgccgtattcaactgtcc
acagctctacacttttttcgtaaagcttttgccaatcagtcagatttatcgaacatcgct
ctgaaggagcagttttatggaagaattaagaatggcgttctcaatgctcttcgtaatcaa
acgttagacattgacagtgaggttaacgctgtttggattatcactaatatgtgttgtatt
agccaggaagttactcacttgtttgtaaactcgaattgtctagatatcttgatcaaactc
gttcggtctcaaaacgctcgtctctcaagtcaaactgtttgggcaattgcaaatattgca
gctgattgttcttcgtgcaaattgaaatgtagatcacctaaacttttgaagatactcgcc
agaaacttacaaacgtcgtataaactcgacgatgcagaccgacgccaactcatttggtgt
gtcaataatattttttccggtggccgaacaacgatgccatcaccagtagctcgttcactt
atttgtgctttgtctgcaattttactcgacacagacgctgtcgataatatgggatgtggt
tcaatgattttatggactcttgccaatttggttgacaactcactagataccacacggatc
gacatgcttctttcccaaaactacgttgttgagcatattctcgaaaaatttattgatcaa
acggacaagtcatgcaatgtttcatgcctccgccttattggaaatattgcagtcgggaat
gatgttcagactgatctgttggttgataatcccaagtttagagttgttatgaatattgca
atgtcatctccggagcatcacagtgaagccgcatggatcatatcaaacgttgttgccggt
gctccaagacacgtggattacataatggatgatccagatgctttctatgaatgggtgatg
gctgggattcatactggagacaaacgcttgagaaaggaatgtctgtggattattggaaat
ctattggcaactgcagatgagcatcaaacgtatcttctcgtctccttaggaatagtacag
cattttccagctcttctcgattttgatgatgttcgtttgaatgaaaaggcggcgacaact
gcaactgaactgctccgtgagcatccatggcagtacacattgttccaacgtttggatatt
ttgggatgtattgagagagctggagcaaacttttcgattcaaaaagccgaactgaaatct
ttgatgaatgacttggcgccacctgaacggaaagatgaagatattgccaaaggatgttct
gtgatttgctacagcaagctctcagacgactttcacagcatgagcatttga

DBGET integrated database retrieval system