KEGG   Caenorhabditis elegans (nematode): CELE_F54D11.1
Entry
CELE_F54D11.1     CDS       T00019                                 
Symbol
pmt-2
Name
(RefSeq) Phosphoethanolamine N-methyltransferase 2
  KO
K05929  phosphoethanolamine N-methyltransferase [EC:2.1.1.103]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CELE_F54D11.1 (pmt-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.103  phosphoethanolamine N-methyltransferase
     CELE_F54D11.1 (pmt-2)
SSDB
Motif
Pfam: PMT2_N Methyltransf_11 Methyltransf_25 Methyltransf_12 Methyltransf_23 CMAS Methyltransf_31 Ubie_methyltran Methyltransf_PK Methyltransf_2 MetW DREV DOT1 PCMT ADH_zinc_N
Other DBs
NCBI-GeneID: 178854
NCBI-ProteinID: NP_504248
WormBase: WBGene00018811
Ensembl: WBGene00018811
UniProt: Q22993
Structure
Position
V:4628580..4635263
AA seq 437 aa
MSSLSIPRQSLYYVNKVTEGRSVSNVQVVSPCQKQGQTYVTAFTPLTSNVQVHTSLEQLS
TIRNADVLIFNNALSQIITNADLLTDFLKNATNATAIGGTVIIREDLKDCSDKRQVARLT
DYFDVFRTTDSDGNNTGLDLYTVDQVEHSNYVEQNFLDFIFVFRKKVFAPTTDATITFRD
FLDKTQYTNTGIDAYEWMFGVNFISPGGYDENLKIIKRFGDFKPGQTMLDIGVGIGGGAR
QVADEFGVHVHGIDLSSNMLAIALERLHEEKDSRVKYSITDALVYQFEDNSFDYVFSRDC
IQHIPDTEKLFSRIYKALKPGGKVLITMYGKGYGEQSDKFKTYVAQRAYFLKNLKEIADI
ANKTGFVNVQTENMTPRFKEILLEERGHLEQNEAEFMSKFTQRERDSLISGWTDKLGYIE
KDNHNWNFFLAQKPFPK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgtcatctctatccattccacgtcaatctttgtattatgtgaataaggtgaccgaggga
cgatcggtgtccaatgttcaagttgtgtcaccgtgtcagaagcagggacaaacctacgtg
accgccttcacaccgctcacctccaacgtccaagtccacacttcgctcgagcaattgagc
actattcgcaacgccgatgtgctcattttcaacaatgctctttcacagattattaccaac
gccgatctcttgaccgatttcttgaagaacgccacaaacgccaccgccatcggtggaacc
gttatcatccgtgaggatctaaaggactgctccgacaaacgtcaagtagctcgtctcacc
gactacttcgatgtcttcagaaccacggattctgatggaaacaacactggactcgatctc
tacacagttgatcaggttgaacactcgaactacgtcgagcaaaacttcctcgacttcatc
ttcgtgttccgcaagaaagtgttcgccccaaccactgatgccaccatcaccttccgcgac
ttcctcgataaaacccaatacacaaatactggaattgacgcctacgagtggatgttcggt
gtgaacttcatctccccaggaggttacgatgagaatctgaagattatcaaaagattcgga
gactttaagccaggacagacaatgctggatattggagtcggaatcggtggtggagctaga
caggttgccgatgagtttggagttcatgttcatggaattgatttgtcttcaaatatgttg
gcaatcgctttggaacgacttcacgaggaaaaggattcacgtgtcaagtactcgattact
gatgcattggtctatcaattcgaggataattcattcgattacgtgttctcgagagattgt
attcaacacattccagacaccgagaagcttttctcaagaatctataaagcactgaaacca
ggaggcaaggtgctcatcacaatgtatggaaagggttacggagagcaaagtgacaagttc
aagacctatgttgctcagagagcatatttcttgaaaaacttgaaggagatcgctgatatc
gccaacaagacaggttttgtcaatgttcagactgagaatatgaccccaagattcaaggag
atccttcttgaagaacgtggtcatttggagcagaatgaggcagagttcatgtcgaagttt
acccaacgcgaaagagattccctcatctctggatggaccgacaagctcggatacatcgag
aaggacaaccacaactggaacttcttccttgcccaaaaaccattcccaaaataa

DBGET integrated database retrieval system