KEGG   Caenorhabditis elegans (nematode): CELE_F55A4.1
Entry
CELE_F55A4.1      CDS       T00019                                 

Gene name
sec-22
Definition
(RefSeq) yeast SEC homolog
  KO
K08517  vesicle transport protein SEC22
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04130  SNARE interactions in vesicular transport
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CELE_F55A4.1 (sec-22)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_F55A4.1 (sec-22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F55A4.1 (sec-22)
Membrane trafficking [BR:cel04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Sec22
    CELE_F55A4.1 (sec-22)
SSDB
Motif
Pfam: Longin Synaptobrevin
Other DBs
NCBI-GeneID: 180456
NCBI-ProteinID: NP_508198
WormBase: WBGene00018853
Ensembl: WBGene00018853
UniProt: Q94241
Position
X:join(1035552..1035629,1035681..1035787,1035855..1036015,1036062..1036205,1036748..1036902)
AA seq 214 aa
MELTLIARVRDGLILATSIEGNNDGSGDSSMVKYSNQAKMLFKKLNGAPAQQSVESGPFV
FHYIIVQNICALVLCDRNFPRKVAFQYLSDIGQEFLNENSSRIEQVVRPYHFLEFDKYIQ
QAKQRYGDTNKHAMNTVSNELQDVTRIMVTNIEDVIHRGEALNILENRASELSGMSKKYR
DDAKALNRRSTIFKVAASIGIAGVLFLMLRFIFF
NT seq 645 nt   +upstreamnt  +downstreamnt
atggagctaacgctaattgcccgtgtacgagacggccttattttggccacatcgattgaa
ggaaacaatgacggcagtggcgactcaagtatggtgaaatactcgaatcaagcaaaaatg
ctcttcaagaagctgaatggggctccagcacagcaaagtgtagagtcaggaccatttgtt
tttcactacataatcgtccaaaacatttgcgccctggtcctctgtgataggaatttcccg
cgtaaagttgccttccagtacctcagtgacattggccaagagtttctaaacgagaacagt
tcgagaatcgagcaagtcgttcgtccataccatttcctcgaatttgacaaatacatccaa
caagctaaacaaagatatggagacaccaacaaacacgcaatgaatacggtatccaatgag
ctccaggacgtcacaagaattatggtcactaatatcgaagatgtcattcatcgaggagaa
gctttgaatattctggaaaaccgagcatccgaattgtctggaatgagcaaaaaatacagg
gatgacgcgaaagccctgaatcgacgatcaaccattttcaaagtagcagcctcgattgga
attgccggagttcttttcctcatgctccgcttcattttcttctag

DBGET integrated database retrieval system