KEGG   Caenorhabditis elegans (nematode): CELE_F55D12.4
Entry
CELE_F55D12.4     CDS       T00019                                 

Symbol
unc-55
Name
(RefSeq) Nuclear hormone receptor unc-55
  KO
K08547  COUP transcription factor 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_F55D12.4 (unc-55)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cel03310]
    CELE_F55D12.4 (unc-55)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    CELE_F55D12.4 (unc-55)
Nuclear receptors [BR:cel03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   CELE_F55D12.4 (unc-55)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 192082
NCBI-ProteinID: NP_001122483
WormBase: WBGene00006790
Ensembl: WBGene00006790
UniProt: G5ECR9
Position
I:complement(join(7899043..7899225,7899607..7899704,7900292..7900373,7900514..7900821,7900865..7900999,7901790..7901917,7903195..7903334))
AA seq 357 aa
MQDGSSGAASLGNSSPDATDCVVCGDKSSGKHYGQFSCEGCKSFFKRSIRRSLSYTCRAT
KNCAIDVQHRNQCQYCRLTKCIRMGMRKEVQRGRLPVTMPSLFPPNMFLRSPFPFMSVPF
NPLMTAQFTKPSIKESIFEFAAQTIFATVNWARTSMSNLVKGDQLILLRHSWTPIFIFAL
AQSNFALNLSTHLTAVTATAASTENGSSSLGSKSEDEEKSEEKPERVFDEPQFQGFQAKI
DKIRDFHLDVVESSSLRAVLLFSCDEEALEEKGKIEEIVEKLKSAVDEYCKMNKRSERYH
QICECLQLLKSTRNLPISRLFFSRLLGTTPLETILSDLLITPPPPTLPFFPQLPSRN
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcaggatggctcatcaggtgctgcaagtcttggaaacagttccccagatgcaacagat
tgtgtagtatgtggagataaatcaagtggaaaacattatggacagttcagttgtgaagga
tgcaaaagtttcttcaaaagatcaattcgacgttcattatcttacacgtgtcgtgctacg
aagaactgtgccattgacgtgcaacaccgaaatcaatgccaatattgtcgattgacaaaa
tgcattcgaatgggaatgagaaaagaagttcaacgaggtcgtctacctgttacaatgcca
agtttgttccctccaaatatgtttttgcgatctccatttccatttatgtctgtaccattc
aatccactcatgactgctcaattcacaaaaccatcgattaaagaatcaatatttgaattt
gcggctcaaacaatctttgcaactgtcaactgggctcgtacaagtatgagtaaccttgtg
aaaggggatcaattgattctgctccgtcacagctggacgcccattttcatttttgcactg
gctcaatcgaatttcgcactcaatctttcaacccatttaactgcagttacggcaacggcg
gcgtcaacagaaaatggatcttcttcgttgggttcaaagtcagaagatgaggaaaagagt
gaagaaaaaccggaaagagtatttgatgagccacagtttcagggatttcaggcgaaaatt
gataagatccgtgactttcatttggatgtcgttgaaagctcgtctcttcgagcggttctt
ctttttagttgcgatgaagaagcattggaggagaagggaaaaattgaagaaattgttgag
aaattgaaaagtgcagtggatgaatattgcaaaatgaataaacgtagtgagagatatcat
caaatctgtgaatgtcttcaacttctcaaatcaactcgaaatcttccaatttctcgtctt
ttcttttctcgacttcttggtacaactcctcttgaaacaattttatcagatcttttaatt
actccacctccaccaacattaccattctttccccaactaccttccagaaattag

DBGET integrated database retrieval system