KEGG   Caenorhabditis elegans (nematode): CELE_F56A11.3
Entry
CELE_F56A11.3     CDS       T00019                                 

Gene name
efn-4
Definition
(RefSeq) Ephrin-4
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 176882
NCBI-ProteinID: NP_499947
WormBase: WBGene00001165
Ensembl: WBGene00001165
UniProt: O44516
Position
IV:join(559238..559335,565482..565831,566581..567084,567752..567846)
AA seq 348 aa
MKQFFEFLITTFLLLGLAAADEHIVYWNSTNSLFRNRQPTIEVRMGDVVRFVCPDNEEGR
NDGEYLIVYEVTEFAMDDCALESHSREVIRCAPEGTAEKVLRTQQLSGGRREDWKKQKVP
PKNVAQLIRQLNPIPNGKEYQPGQTYYYMTTSTGKANGTNHRMYGLCESQNMRLSMKVSA
SQPHPTRRAPTRRQEDFVTTASAELMGGQEDEDSDNDNAHLLPRDLEGSTNPKFRRPSQL
ETAGVENQQFMKVVQMAQAGKTGTFENEKEAIAQKSSEKDGWHPVNVQYVADLMNNAYQN
ADERISYQRDFEIHEENDLAVKSLEYSSSSTSLSTNFAILLAVIYVLY
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaaacaattcttcgaatttttaataacaacatttttgctactcggactggccgctgca
gacgagcacattgtctactggaactctacaaattcactgttccgaaatcggcagccaacg
atcgaagttcgaatgggagacgttgttcgatttgtgtgtccggacaatgaggagggacga
aacgatggcgagtacctgattgtctatgaagtaaccgagttcgcgatggatgactgtgct
ctggagtcacactcgagagaagttatacggtgtgcacccgaagggactgcagagaaggtg
ctcagaactcagcagttgagtggcggaagacgggaagactggaagaagcagaaagttccg
ccgaagaatgtggctcagctcatcaggcagctcaatcctattccgaatgggaaagagtat
caaccagggcagacgtattattatatgacaacatcgactggaaaagcgaatggcaccaac
catcggatgtacggattatgtgaatctcaaaacatgcggctctcgatgaaagtgtctgcc
agtcaacctcacccaactcgccgagcaccaactcgccgacaggaggattttgtgacaact
gcgagcgccgaattgatgggcggacaggaggatgaagattcagataacgacaatgcccat
ctgctgccgagggacttggaaggatcgacgaatccaaagtttcgaagaccatcgcaattg
gagacggcaggagttgagaatcagcaatttatgaaggttgtccaaatggctcaggctggc
aaaactggcacatttgaaaacgagaaagaggcgatcgcgcagaaaagttcggaaaaagac
ggatggcatccggtgaacgtgcaatatgtggctgatctaatgaataatgcatatcagaat
gctgatgagaggatttcttatcaaagggattttgaaattcacgaggagaatgatcttgct
gtaaaatccttggaatattcatcatcttcaacttcattatcaacaaattttgcaatttta
ctagctgtaatctatgttctatattaa

DBGET integrated database retrieval system