KEGG   Caenorhabditis elegans (nematode): CELE_F56A8.7Help
Entry
CELE_F56A8.7      CDS       T00019                                 

Gene name
unc-64
Definition
(RefSeq) Syntaxin-1A homolog
  KO
K04560  syntaxin 1A
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    CELE_F56A8.7 (unc-64)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F56A8.7 (unc-64)
Membrane trafficking [BR:cel04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    CELE_F56A8.7 (unc-64)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Lzipper-MIP1 MCPsignal adh_short_C2 adh_short CAP_N DUF2205 IFT46_B_C Dna2 Fib_alpha
Motif
Other DBs
NCBI-GeneID: 176743
NCBI-ProteinID: NP_001022615
WormBase: WBGene00006798
Ensembl: WBGene00006798
UniProt: O16000
Position
III:join(13277369..13277382,13277428..13277527,13278567..13278666,13279235..13279489,13279873..13279967,13280217..13280333,13280547..13280657,13283787..13283870)
Genome map
AA seq 291 aa AA seqDB search
MTKDRLSALKAAQSEDEQDDDMHMDTGNAQYMEEFFEQVEEIRGSVDIIANNVEEVKKKH
SAILSNPVNDQKTKEELDELMAVIKRAANKVRGKLKLIENAIDHDEQGAGNADLRIRKTQ
HSTLSRRFVEVMTDYNKTQTDYRERCKGRIQRQLDIAGKQVGDEDLEEMIESGNPGVFTQ
GIITDTQQAKQTLADIEARHNDIMKLESSIRELHDMFMDMAMLVESQGEMVDRIEYNVEH
AKEFVDRAVADTKKAVQYQSKARRKKICILVTGVILITGLIIFILFYAKVL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggacagattgtccgctttaaaagcggcgcagtccgaggatgagcaggacgat
gatatgcacatggacaccgggaatgcacaatatatggaggagttttttgagcaggttgaa
gagattcgtggaagtgtggatattattgcgaataatgttgaagaggtcaagaagaagcat
tcggcaattttatcaaatccagttaacgatcagaaaaccaaagaagaactcgacgagttg
atggcagttatcaaaagagctgcgaataaagtgcgcggcaaactgaaattgatcgaaaat
gccattgatcacgacgagcaaggagccggaaatgcggatcttcgaattcgaaaaactcaa
cacagcacattatcgagacgattcgtcgaagtgatgactgattataataagacacagact
gattatcgagagaggtgtaagggacgaattcagagacaactcgatattgctggaaaacaa
gtcggagatgaggatttggaggaaatgattgagagcggaaatccgggagtatttacacaa
ggaatcatcacagatacccaacaggcaaaacaaacgctagccgatattgaagctcgtcac
aatgatatcatgaaattggaaagttcaattcgagagcttcacgacatgttcatggatatg
gctatgcttgtcgaatctcagggagagatggttgatcgaattgagtacaatgtggagcac
gcgaaagaatttgttgatcgagcagtagctgatacgaagaaagccgttcaatatcagtcg
aaggcgcgaaggaagaagatttgcatccttgtcaccggcgtcatactcatcactggccta
attatttttattttgttttatgcgaaagtattataa

DBGET integrated database retrieval system