KEGG   Caenorhabditis elegans (nematode): CELE_F56C3.6
Entry
CELE_F56C3.6      CDS       T00019                                 

Gene name
dgn-2
Definition
(RefSeq) Peptidase S72 domain-containing protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: DAG1 CLAMP
Other DBs
NCBI-GeneID: 186365
NCBI-ProteinID: NP_508253
WormBase: WBGene00018943
Ensembl: WBGene00018943
UniProt: O61756
Position
X:complement(join(1365474..1366326,1366372..1366598,1367397..1367516))
AA seq 399 aa
MIPKPNFLLLLVLLSSVFTARVIVSRKQAIDWAAFGDSTTATSPTDRTVDWKSESLLDDL
EESRMKNEIGEQLPKTKNELEVVLNALDMEQLKGSKTKLNDDNVAKQKHMIFKCKSGSIC
RMDVSDQLQISKNATVFIHSLDDAEVWMDSQHGRDFIGVPISEGKFHYLIAFHEPNGRIH
EVPIEIDVEDYPSPNHLFKLVISDPAVEIFDNFPHYRTIFIETLAEALNSDMDLIALDEI
YEVRDYTIISFFNNSLSTSTCDSKAIIKVAEKMYYTNGRKPSARFLTKMGEDFVVKNAMF
SAIGQCKGVFSSPRPTTRTSNTTTAAMTTLKPSLKKGSSTTGTILSLGTICAIVVILHYG
CKKEVKEEKTPDNEPLIPSEQTLGHMQEINLNDEEENSV
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgattcccaaaccgaatttccttttgctcctcgtactgctgagctccgtcttcaccgct
cgcgtcattgtctccagaaagcaggctatcgattgggcagcgtttggcgattcaactacg
gctacatctcctacggaccgcactgtcgactggaagtcggagagtcttctggatgacctg
gaagaatcgaggatgaagaacgagattggtgagcaacttccgaaaactaagaatgaattg
gaggttgttctgaatgcacttgacatggagcagcttaagggctccaagaccaaactcaac
gatgacaatgttgcgaagcagaaacatatgattttcaagtgcaagagtggtagcatctgc
cgaatggatgtctccgatcaactgcaaatctcaaagaacgccactgtcttcattcactct
cttgatgacgccgaagtttggatggattcgcaacatggtcgagatttcattggtgtaccc
atatccgagggaaaattccattacctgatcgctttccacgagccgaacggaagaattcac
gaggttccgatagaaatcgatgtcgaagactatccatctccgaaccacttgttcaagttg
gtaatatccgatcctgccgtggagattttcgacaatttcccacactaccgcacgattttt
attgaaacactcgcggaggctctcaacagtgatatggatttgattgctcttgatgagatc
tacgaagttcgggactacaccattatctcgtttttcaacaactcattgtcgacgtcaact
tgcgattccaaggctatcatcaaggttgctgagaagatgtactacaccaacggtcggaaa
ccttcagctcgcttcctcaccaagatgggagaagatttcgtggtaaaaaacgcaatgttc
agcgcaattggtcagtgcaaaggagttttctcttcgccaaggcctactacaagaacttct
aacactactacagccgctatgacaactctcaagccgagtctcaaaaaaggaagcagcact
actggcaccattttgtccctgggtaccatttgtgctatcgttgttattttgcactacgga
tgcaagaaggaggtgaaagaggagaaaaccccggacaacgagccgctgatcccgtctgag
caaaccttgggtcacatgcaagagatcaatctcaacgatgaagaggagaatagcgtttag

DBGET integrated database retrieval system