KEGG   Caenorhabditis elegans (nematode): CELE_F56D1.7
Entry
CELE_F56D1.7      CDS       T00019                                 

Gene name
daz-1
Definition
(RefSeq) DAZ protein 1
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 173931
NCBI-ProteinID: NP_495036
WormBase: WBGene00000935
Ensembl: WBGene00000935
UniProt: Q20870
Position
II:join(5456334..5456561,5456617..5456848,5456899..5457180,5457228..5457466,5457548..5457920,5458002..5458144)
AA seq 498 aa
MSPPLRYQKDQQNQQHQQNQSQQAAHQMVSFMPQTPTSLPSTPIQLYPTGAAALIPAPPT
YELIPNRIFVGGFPTSTTETELREHFEKFFAVKDVKMVKSLDGQSKGYGFITFETEDQAE
EIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPSYAIATPSQLVAASPGPFSYAIPASPS
PYSGYSYPASPQMFVYPPLRSQDQSRQQSEQQTTPQNSPTNLQHQQSPQVFFGGDQDPIR
SYASAVAGVEKSEVSPEKHESVSPQPLLPNQNVLNTQYSQGQQQWNSNVQQQQQQQMDSN
NGGPYYNENYSQGYTRPHPYQQFAQSGVYMNSQGMYHSSYSYMTPPLAPGQYPQMMSAPY
WQQQQQHHQSHAYAGYNPAYNNWVGPSGDMNQFKQNPSNYFYQNYPGNFSQQHTMGNNEN
TFSLPLQAPRQGKKSRKPSECQDKKTKSPIKGARTERPSSSASTPDAKYQKNHRYPVHLS
PLSASLQSLAISSPTKNN
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtcgccgcctctacggtatcaaaaagaccaacaaaatcagcaacatcagcaaaatcaa
tcacagcaagctgctcatcagatggtctctttcatgccacaaacaccgacttctcttcca
tcaactccgatacaactttatccaaccggagcagccgcactaataccagcaccacctaca
tacgagctgattccaaaccgtattttcgttggtggcttcccaacttcgaccacagaaact
gagttgcgtgaacatttcgagaaattcttcgctgtgaaggacgtcaaaatggttaaatca
cttgatggtcagtcaaagggatacggatttatcaccttcgaaaccgaagatcaagcagag
gaaattcgtaaactgactccaaagcagttggaattccgtagcaggaagctcaacctaggt
ccagcgatccgaaaaataaactccaatagttttcaaccaagctacgcaatcgccactcca
agtcagctcgttgcggcatctccaggaccattcagctacgccattccggcatctccaagt
ccatatagcggatactcctatcctgcttcgcctcagatgttcgtctatcctccgttacgc
agtcaggatcaaagcaggcagcaatctgagcaacaaactactccgcagaatagtcctact
aatctgcaacatcaacaatcgccacaagtcttcttcggtggagatcaagatccaataaga
tcttatgcgagtgcagttgcaggagttgaaaagtccgaagtttcccctgaaaagcatgaa
tcagtttctccacaaccacttcttccaaatcaaaatgtgttgaacactcagtattcccaa
ggtcagcagcagtggaattccaatgtgcagcagcagcagcaacaacaaatggactcgaac
aacggaggtccttactataatgaaaattattctcaaggctacacccgtcctcatccatat
caacagtttgctcaatctggggtgtacatgaacagccaaggaatgtaccattcgagttat
tcctacatgactcctccactggcaccaggtcaatatccacaaatgatgtccgctccctat
tggcaacagcaacaacagcaccatcaaagtcatgcatacgctggctataatcccgcctac
aacaactgggttggaccatctggagatatgaatcagttcaaacaaaatccgtcaaactac
ttctatcaaaattatccgggaaatttttcacaacaacacacgatgggaaacaatgaaaat
acattctcccttcccctccaagctccacgccaaggcaagaagagccggaaaccatcggaa
tgtcaggataagaagacaaaaagcccaatcaaaggagctcgcactgagagaccatcgtca
tcagcttcgactccagacgcgaaatatcagaagaaccacagatatccagttcatctttct
ccactttcagcatccctccaatcactagccatttcctcgcccactaagaataattaa

DBGET integrated database retrieval system