KEGG   Caenorhabditis elegans (nematode): CELE_F56H11.3Help
Entry
CELE_F56H11.3     CDS       T00019                                 

Gene name
elo-7
Definition
(RefSeq) Elongation of very long chain fatty acids protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 186426
NCBI-ProteinID: NP_001255397
WormBase: WBGene00001245
Ensembl: WBGene00001245
UniProt: Q20904
Position
IV:join(9529987..9530199,9530289..9530469,9530517..9530655,9530739..9530849,9530897..9531032,9531078..9531227)
Genome map
AA seq 309 aa AA seqDB search
MYLNYFATEIFHRSAVCETEACRSSKIMIADVFKWKFDANELWSLLTNQDEVFPHIRARR
FIQEHFGLFVQMAIAYVILVFSIKRFMRDREPFQLTTALRLWNFFLSVFSIYGSWTMFPF
MVQQIRLYGLYGCGCEALSNLPSQAEYWLFLTILSKAVEFVDTFFLVLRKKPLIFLHWYH
HMATFVFFCSNYPTPSSQSRVGVIVNLFVHAFMYPYYFTRSMNIKVPAKISMAVTVLQLT
QFMCFIYGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSYFVLFANFFHKAYLQRGGKRE
HPNQTKKIN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtatttgaattatttcgcgacggaaatcttccatcgtagtgcggtttgtgaaacagaa
gcttgtcgctcgtcaaaaataatgattgctgacgtgttcaaatggaaattcgatgcaaac
gaattgtggagtcttttaacgaatcaggatgaagttttcccgcatattagagcacggcga
ttcattcaagaacattttggtctattcgtccagatggcaattgcatatgtcattttggtg
ttctcaatcaaaaggttcatgagggatcgtgaaccatttcaactcaccacagctcttcgt
ctctggaacttcttcctctccgtcttctcaatttatggttcctggacaatgtttccattt
atggttcaacaaataagactttatggtctctacggatgtggatgcgaagcactttcaaac
cttccgagtcaagcagaatattggcttttcctgacgatcttgtccaaagctgtggagttt
gttgatacatttttcttggttctccggaaaaaaccactcatcttcctacactggtatcat
catatggcaacatttgtcttcttctgcagtaattacccgactccatcgtcacaatcacgc
gtcggagttatcgtcaacctgttcgtgcatgccttcatgtacccatactatttcacccga
tcaatgaacatcaaagttcctgcgaaaatttcaatggctgttacagttcttcaattgact
caattcatgtgctttatctatggatgtactctcatgtactactcgttggccactaatcag
tacacctgcgacactccaatgtttgtcctacactctacatttgctttgagcagttcctat
tttgtgctctttgccaacttcttccataaggcttatttgcaacgaggaggaaaacgagaa
catccgaatcagacaaagaaaattaactaa

DBGET integrated database retrieval system