KEGG   Caenorhabditis elegans (nematode): CELE_F57B10.3Help
Entry
CELE_F57B10.3     CDS       T00019                                 

Gene name
ipgm-1
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel00260  Glycine, serine and threonine metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01230  Biosynthesis of amino acids
Module
cel_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cel_M00002  Glycolysis, core module involving three-carbon compounds
cel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_F57B10.3 (ipgm-1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CELE_F57B10.3 (ipgm-1)
Enzymes [BR:cel01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     CELE_F57B10.3 (ipgm-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme iPGM_N Phosphodiest Sulfatase Alk_phosphatase PglZ
Motif
Other DBs
NCBI-GeneID: 172376
NCBI-ProteinID: NP_491896
WormBase: WBGene00019001
UniProt: G5EFZ1
Structure
PDB: 

Position
I:join(6569609..6569660,6570087..6570224,6570274..6570428,6570476..6570581,6570629..6570776,6570978..6571104,6571376..6571810,6571854..6572201,6572320..6572430)
Genome map
AA seq 539 aa AA seqDB search
MFVALGAQIYRQYFGRRGMAMANNSSVANKVCLIVIDGWGVSEDPYGNAILNAQTPVMDK
LCSGNWAQIEAHGLHVGLPEGLMGNSEVGHLNIGAGRVIYQDIVRINLAVKNNKFVTNES
LVDACDRAKNGNGRLHLAGLVSDGGVHSHIDHMFALVKAIKELGVPELYLHFYGDGRDTS
PNSGVGFLEQTLEFLEKTTGYGKLATVVGRYYAMDRDNRWERINVAYEAMIGGVGETSDE
AGVVEVVRKRYAADETDEFLKPIILQGEKGRVQNDDTIIFFDYRADRMREISAAMGMDRY
KDCNSKLAHPSNLQVYGMTQYKAEFPFKSLFPPASNKNVLAEWLAEQKVSQFHCAETEKY
AHVTFFFNGGLEKQFEGEERCLVPSPKVATYDLQPEMSAAGVADKMIEQLEAGTHPFIMC
NFAPPDMVGHTGVYEAAVKACEATDIAIGRIYEATQKHGYSLMVTADHGNAEKMKAPDGG
KHTAHTCYRVPLTLSHPGFKFVDPADRHPALCDVAPTVLAIMGLPQPAEMTGVSIVQKI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtagccctgggcgctcaaatttatcggcaatatttcggacgacgcggaatggcg
atggcaaataacagttcggtggccaataaggtctgtctcatcgttattgatggatgggga
gtttctgaagatccttacggtaacgctattctcaacgcacagacaccagttatggacaag
ctgtgttcgggcaattgggctcaaattgaggcacatggtcttcatgttggtctcccagaa
ggattgatgggaaattcggaagtcggacatttgaacatcggagccggacgtgttatctat
caagacattgttcgtattaatctggcagtcaagaacaacaaatttgtgactaatgagagc
ttggtggatgcttgcgatcgtgctaaaaacggaaatggacgtcttcatctggccggactt
gtttctgacggaggtgttcattctcatattgatcacatgtttgctttggttaaggccatc
aaagagctcggagttccagaactttaccttcatttctacggagatggtcgtgatacttct
ccaaacagtggagttggattccttgaacaaaccctcgagttcttggagaaaactactgga
tatggaaaactagctactgtagttggccgctactatgctatggatcgcgataacagatgg
gagcgtatcaatgttgcatacgaggcaatgattggaggtgttggagagacttccgatgag
gctggggttgttgaagttgttcgcaagcgttacgctgctgatgaaacagacgaattcttg
aagccaatcattcttcaaggagagaaaggacgtgttcaaaatgacgatacaatcatcttc
ttcgactaccgtgctgatcgtatgcgtgagatttctgcagcaatgggaatggatcgttac
aaggattgcaattcgaagttagctcatccatcaaatcttcaagtatatggaatgactcaa
tacaaagccgagttcccattcaaatcgctgttcccgccagcatcgaacaaaaatgtattg
gctgagtggctcgccgagcaaaaagtttcgcaatttcattgtgcggaaaccgaaaaatac
gctcacgttacatttttcttcaatggaggacttgaaaaacaatttgagggagaagaaagg
tgtttagtgcccagtccaaaggtcgcaacttacgatcttcaaccagaaatgtctgcggcc
ggcgttgctgacaaaatgattgaacaactcgaggctggaactcatccattcattatgtgc
aactttgctccaccagatatggtcgggcatacgggagtctatgaagctgctgtcaaggcc
tgtgaagctactgatatcgcaatcggaagaatctatgaagcaactcaaaagcacggatac
tcacttatggttactgctgatcacggaaatgctgaaaagatgaaggctccagatggtgga
aaacacactgctcacacatgttaccgtgttccactcactttgagccatccaggattcaaa
tttgtcgatccagccgaccgtcatccggccctttgtgatgttgctccaacagttctcgct
attatgggactccctcaaccagctgaaatgactggggtctcgattgttcagaagatctag

DBGET integrated database retrieval system