KEGG   Caenorhabditis elegans (nematode): CELE_F58B3.5
Entry
CELE_F58B3.5      CDS       T00019                                 

Gene name
mars-1
Definition
(RefSeq) Methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00450  Selenocompound metabolism
cel00970  Aminoacyl-tRNA biosynthesis
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CELE_F58B3.5 (mars-1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CELE_F58B3.5 (mars-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cel01007]
    CELE_F58B3.5 (mars-1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cel03016]
    CELE_F58B3.5 (mars-1)
Enzymes [BR:cel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CELE_F58B3.5 (mars-1)
Amino acid related enzymes [BR:cel01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CELE_F58B3.5 (mars-1)
Transfer RNA biogenesis [BR:cel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CELE_F58B3.5 (mars-1)
 Prokaryotic type
   Other AARSs
    CELE_F58B3.5 (mars-1)
SSDB
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e zinc-ribbons_6
Other DBs
NCBI-GeneID: 178089
NCBI-ProteinID: NP_001255570
WormBase: WBGene00003415
Ensembl: WBGene00003415
UniProt: Q20970
Position
IV:complement(join(11632167..11632298,11632372..11633030,11633082..11633186,11633517..11634970,11635017..11635340,11635393..11635472))
AA seq 917 aa
MGHDLADIKKSFEASLPGYVEKKDPKSILPQPGKRNILITAALPYVNNVPHLGNIIGCVL
SADVFARYCNLRGHQTFYVGGTDEYGTATETKALQEGCTPRELCDKYHAIHKGIYEWFGI
DFSHFGRTTTDHQTEICQDMFLKLHKNGYTSSQSVDQLYCNQCEKFLADRFVTGTCPMCA
YDDARGDQCDGCGKLINAVDLKDAKCHMCKATPEVKQSTHIFLSLDKLQQKTTEHLDREL
AKEDNRWSSNAVGITKAWMKLGLDPRCITRDLKWGTAVPLDGFEKKVFYVWFDAPIGYLS
ITKCVLGDNWTKWWKNPENVELFNFVGKDNVAFHAVMFPCSQLGANDNYTVVNNLCATEY
LNYEDTKFSKSRGTGIFGDAAQGTEIPADIWRFYLLYMRPESQDTAFSWDDFVLKVNSEL
LNNLGNFINRALSFVANSFGGVVPEMNLTNDDAEVLSEIHNECMQWDKQFDGVHLKDAVK
TILNVSRLGNQYMQAQTPWVLMKKDEEGKKRAGTIIGVAANIAYHVSVLLYPIMPTISAT
IREQCGLPALPLFTPFPICYLKAGHKIGQPSPLFQKLDPAQIAEFKAKFGGSQDAQSSAP
KTAEKPKQQKKQAPTKDKKGDKKMASTAAFVELEQGAKVISQLIAQNLKKFDQAKALFTR
NQLQRLDGENKQLTIDVKTLQHQLIELETAAGIKQVPKPVVSCTPTPTSTPASGIITEAP
KKEAPSTPAPSEPKKAKEQKKGKGGAAAAPVDDTIDVGRLDMRVGRIIKCEKHPDADALY
VEQIDVGESAPRTVVSGLVRHVPLDQMQNRLVVVLCNLKPAKMRGVESRAMVMCASSPDK
VEIMEVPADSKPGTPVVCPPYTHRPDEQLNPKKKIWETVAEDLKVSAEGFAEWKGQPLLI
GSESKMTAPTLRGVHVK
NT seq 2754 nt   +upstreamnt  +downstreamnt
atgggtcacgacttggcggatataaaaaaatctttcgaggcaagtttgccgggatatgtt
gagaagaaagatccaaaaagtattctaccgcaaccaggaaagcgaaacattttgattact
gctgcattgccatacgtgaacaatgttccacatctcggaaacattattggatgtgttctc
agtgctgatgtctttgcccgttattgtaatctacgaggacatcaaaccttttacgttgga
ggaacagatgagtatggaacggcaacagaaacaaaagcacttcaagagggatgtactcca
cgagagttatgtgacaaatatcatgccattcataagggaatctatgagtggttcggaatt
gatttctctcatttcggaagaaccaccactgatcatcaaactgaaatttgtcaagacatg
tttttgaaacttcacaaaaatggctacacatcatcgcaatcggtggatcagctgtactgc
aaccaatgcgaaaaattcttggctgatcgattcgtcaccggaacttgtccaatgtgcgct
tatgatgatgctcgtggagatcagtgtgatggatgtggaaagttgatcaatgctgtggat
cttaaggacgcgaagtgtcatatgtgtaaagcaactccagaagtgaaacagtccacgcac
atcttcttatcacttgacaagcttcaacagaaaacaacagaacacttggatcgtgaatta
gctaaagaagataatcgctggtcatcaaatgctgttggaattaccaaggcttggatgaag
ttaggattggatcctcgttgcatcacaagagatctcaaatggggaacggctgttccattg
gatggattcgagaagaaagtgttctacgtatggtttgacgccccaattggttatctttca
atcacaaaatgtgtactcggtgataactggactaaatggtggaagaatccagagaatgtt
gagctgttcaatttcgtcggaaaggacaatgtagctttccacgccgtcatgttcccttgt
tctcaattgggtgccaatgacaactatacagttgttaataatctctgtgccactgaatat
ctcaactatgaggacacaaaattcagcaagtcacgtggaaccggaattttcggagatgca
gctcaaggaactgaaattccagcagatatctggcgattttacctcttatacatgagaccc
gaaagccaagatactgcttttagctgggatgactttgtgttgaaagttaacagcgaattg
ctgaataatcttggaaatttcatcaacagagcactttcgttcgtcgcaaactcttttgga
ggagttgttccagaaatgaatttgacaaatgatgacgcagaagttctttctgaaattcac
aatgaatgtatgcaatgggataagcagttcgacggagttcatctcaaagatgctgtgaag
actattctaaatgtttctcgtcttggtaaccaatatatgcaagctcaaactccatgggtg
ctcatgaaaaaggatgaagaaggaaagaagagagctggaacaatcatcggagtggctgct
aacatcgcctatcatgtttctgttcttttatacccaatcatgccaacaatttctgcaaca
atccgtgaacagtgtggtttaccagcacttcctctcttcactccattcccgatttgttat
cttaaagccggtcacaaaatcgggcaaccatcccctcttttccaaaaactcgatcctgca
caaattgccgaattcaaagcaaagtttggtggttctcaagatgcccagagctccgctcca
aaaactgccgaaaagccaaaacaacagaagaagcaagcacccaccaaagataaaaaggga
gacaaaaagatggcgtcaactgctgcttttgtggaacttgaacaaggagccaaggttatt
tcgcaactcatcgctcaaaatctgaaaaagtttgatcaagccaaggccctcttcacccga
aatcagctccagagattggatggagagaacaagcagcttacgattgatgttaaaacactt
cagcatcaattgattgaactggaaactgctgccggaatcaagcaagtgccaaaaccagtt
gtttcgtgtacaccaacaccaacttctactccagcttctggaattatcacagaagctcca
aagaaagaggctccttcaactccagcaccttccgagccgaagaaagctaaggagcagaag
aaaggaaagggtggggctgctgcggctccagtcgacgatacaatcgatgtgggaagactc
gatatgcgcgttggtcgaatcatcaagtgtgagaagcatcctgatgcagatgctctttac
gtggaacagatcgatgttggagagtcagccccgcgaactgtagtttctggactcgttcgt
cacgttccactcgatcaaatgcagaaccgccttgtcgttgtgctttgcaatctgaaacca
gcaaaaatgcgtggagtagagtcccgagccatggttatgtgtgcttcatcacctgacaaa
gttgagattatggaagttccggctgattccaaaccaggtactccagtcgtctgcccacca
tatacacacagacctgatgagcaattgaatccaaagaaaaagatctgggagacagttgca
gaggacttgaaggtttcggctgaaggcttcgcagagtggaaaggacaaccgcttctcatt
ggaagtgaatccaaaatgactgccccaacgcttcgtggagtccatgtgaaataa

DBGET integrated database retrieval system