KEGG   Caenorhabditis elegans (nematode): CELE_F58E6.1Help
Entry
CELE_F58E6.1      CDS       T00019                                 

Gene name
sta-2
Definition
(RefSeq) Signal transducer and activator of transcription B
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAT_bind SH2
Motif
Other DBs
NCBI-GeneID: 3565291
NCBI-ProteinID: NP_001122963
WormBase: WBGene00010251
Ensembl: WBGene00010251
UniProt: Q20977
Position
V:join(9741223..9741342,9741421..9741890,9741991..9742107,9742156..9742246,9742294..9742407,9742450..9742533,9742657..9742878,9743189..9743325,9743376..9743509,9743892..9744010,9744136..9744231)
Genome map
AA seq 567 aa AA seqDB search
MSSVVSDQMDIESSSAFSPAEPVVDGAFVSKHNLSAEAYQGFKECADSLLSGKIAQNEQL
PFIQRTLQICENVILNFEDEKQHLMSDVLLVWAMKQQKLSIATLHTQQLHYKELDLINLQ
FEYFGELLQQTLSGLDYLKQYYPNVGFEEVHSKVRNLTHYFLYYSIIVSRQPPSVIVKCG
EAENHRRSRFWFNTEIRILGGSAFGIDTNNENSNVNCYLITDETAKQLLNNAYLDIFESE
EFCIEPNTSTFQKKDARGIKAKFDDMKVAKKVALRRDSVATKRYCLCYNIQLQTNCGIEL
VGKKVSLPFAVLVGPKADVEAKLFLERSFADLVRHPLSDIPTHVSCAEMADALEMKFQAI
IETPQKNTDGPSVVQPRKFNMQTKQHLVMRMKPNNQGFLPLDNFMKLPVAEEFQHKKSAS
AEGDWKLVPFYDWFFKLAEITNKYLYSMWYDGLVYGFCSKEDAENILRCIPRSVLLVRFS
DIEYGKIKISVKNRNGEIRHHWYEHADLNARSLNSELLSNHKFSDVDLIYPDIDLEVALG
GRNKPRIRLPRNLAPDEIYFDNQGAAT
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtggtatctgaccaaatggacattgagtcctcttctgcattctccccagcc
gagccagttgtagatggagcattcgtgtcaaaacataatttgagcgcggaagcatatcag
ggtttcaaagaatgtgcagattcccttttatcggggaaaattgcccaaaatgagcaactc
ccattcattcaacgaacgctgcaaatttgtgaaaatgtgatcttgaatttcgaagacgaa
aaacaacatttgatgagcgatgtacttcttgtatgggctatgaaacaacagaagcttagt
attgcaactcttcacacccaacaattacattacaaagaattagatttgatcaatttacaa
tttgaatattttggggaacttttgcaacagacactctcaggacttgattacttgaagcaa
tactatccgaacgtcggatttgaagaggttcattcaaaagttcgcaatttgacccattat
ttcctttactactcaatcattgtcagtcgtcaaccaccatcagtgattgttaaatgtggt
gaagcagagaatcatagaagaagcagattctggtttaatactgagataagaattcttggt
ggatccgcttttggaattgatacaaacaatgagaattcaaatgttaattgttacttgatt
accgatgagactgctaagcaattactaaataatgcttaccttgatatttttgaatctgaa
gaattctgtattgagccaaacacatccacgtttcaaaaaaaagatgcaagaggaataaaa
gcgaaatttgacgatatgaaagttgcaaaaaaggttgcacttcgtcgagattccgttgct
acaaaacgatattgtctgtgctataatattcaattgcaaacaaattgtggaattgaactt
gtcggaaaaaaggtttcgcttccatttgctgttcttgttggtccaaaagcagatgttgag
gcaaaattgttcctcgaaagatcttttgctgacttggtccgccatccgctttcggatatt
cccactcatgtatcttgtgctgaaatggctgatgctctggaaatgaaatttcaagcaatc
atagaaacacctcaaaaaaatactgatggaccttctgttgttcaaccgagaaaattcaat
atgcaaacaaaacaacacttggtgatgagaatgaaaccaaataatcaaggatttttgcca
cttgataattttatgaagcttccggttgcagaagaattccagcataagaaaagtgcctct
gcggaaggggattggaaattggtgccattctacgactggttctttaaacttgcagaaatt
acaaataagtacctatacagtatgtggtatgacggcttggtttatgggttttgcagtaaa
gaagacgcagagaatattttgagatgcataccgagaagtgttttgttggttcgattttcg
gatattgaatacggaaaaattaagatttcagtaaagaataggaatggtgaaattcgtcat
cactggtacgagcacgctgatctaaatgctcgatccctgaattcagaacttctttcaaat
cacaagttctccgacgtcgatctcatttatccagacattgatctagaggttgctctcgga
ggacggaataagccacgtattcgacttccacgcaatcttgctcccgacgaaatctatttt
gataatcaaggagccgccacttga

DBGET integrated database retrieval system