KEGG   Caenorhabditis elegans (nematode): CELE_F59D8.1Help
Entry
CELE_F59D8.1      CDS       T00019                                 

Gene name
vit-3
Definition
(RefSeq) Vitellogenin-3
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Vitellogenin_N DUF1943 VWD HEAT_2 Methyltrn_RNA_4
Motif
Other DBs
NCBI-GeneID: 24104675
NCBI-ProteinID: NP_001294839
WormBase: WBGene00006927
Ensembl: WBGene00006927
UniProt: Q9N4J2
Position
X:complement(join(3567458..3567717,3567769..3567904,3567954..3568182,3568232..3571269,3571317..3571601,3571677..3572540))
Genome map
AA seq 1603 aa AA seqDB search
MKSIIIASLVALAIAASPALDRTFSPKSEYVYKFDGLLLSGLPTTFSDASQTLISCRTRL
QAVDDRYIHLQLIDIQYSASHIPQSEQWPKIKSLEQRELSDELKELLELPFRAQIRNGLV
SEIQFSSEDAEWSKNAKRSILNLFSLRKSAPVDEMSQDQKDMESDKDSLFFNVHEKTMEG
DCEVAYTIVQEGEKTIYTKSVNFDKCITRPETAYGLRFGSECKECEKEGQFVKPQTVYTY
TFKNEKLQESEVHSIYTLNVNGQEVVKSETRSKVTFVEESKINREIKKVSGPKEEIVYSM
ENEKLIEQFYQQGDQAEVNPFKAIEMEQKVEQLDEIFRQIQEHEQNTPETVHLIARAVRM
FRMCTIEELKKVHTTIYTKAEKKVQLVIETTLAVAGTKNTIQHLIHHFEKKSITPLRAAE
LLKSVQETLYPSEHIADLLIQLAQSPLSEKYEPLRQSAWLAAGSVVRGFASKTQDLPLIR
PASRQTKEKYVRVFMQHFRNADSTYEKVLALKTLGNAGIDLSVYELVQLIQDPRQPLSIR
TEAVDALRLLKDVMPRKIQKVLLPVYKNRQNKPELRMAALWRMMHTIPEEPVLAHIVSQM
ENESNQHVAAFTYNVLRQFSKSTNPCYQQLAVRCSKVLLFTRYQPQEQMLSTYSQLPLFN
SEWLSGVQFDFATIFEKNAFLPKEVQASFETVFGGNWNKYFAQVGFSQQNFEQVILKTLE
KLSLYGKQSDELRSRRVQSGIQMLQEIVKKMNIRPRVQQTDSQNAHAVFYLRYKEMDYIV
LPIDMETIDNVVEKYVRNGEFDIKSLLTFLTNDSKFELHRALFFYEAERRIPTTIGMPLT
ISGKMPTILSINGKVSIELEKLGARLVLDIVPTVATTHVTEMRFWYPVIEQGVKSLQSAR
LHTPLRFESTVELKKNTLEITHKFVVPENKKTTVSVHTRPVAFIRVPKNQDSEYVETEEK
TISHSQYQMSTEEIDRQYETFGLRINAQGNVLSQWTLPMVLMTEQDFEFTLENKNRPVEF
TARVTIGNLEKTDLSEIKFDKIFEKEFDLENNESENRRQYFHKMIREIQSEQGFKNLITL
KLEAPQQMYWNTELRTVCDKWIRMCKVEMDARRSPMEHENKEWTLRTELLAARPQMPSSL
RQLREQPHREVQLALNAKWGSSKKSEITFNAQLEQSTEQKKFLRNIEREYKGIPEYELLI
KAARLNQVNVVSEYKLTPESEYTFSRIFDLIKAYNFWTVSEKRVQNEDRRVVLQLSVEPL
SRQYMNMTIQTPEQEVELKNVRIPRVVLPTIARRAMFQQTWEKTGATCKVGQSEVSTFDN
VIYRAPLTTCYSLVAKDCSEQPRFAVLAKKINKNSEELLVKVVRREEEIVVKKSDDKFLV
KVDEKKVNPTELEQYNIEILGDNLIVIRLPHGEVRFDGYTVKTNMPSVASQNQLCGLCGN
NDGERDNEFMTADNYETEDVEEFHRSYLLKNEECEVENDRISEKKNYRNKWNREEKKSDY
VSSSDYENNYDEKETENQLFKKTLIKEFSNRVCFSIEPVSECRRGLESEKTSNEKIRFTC
MPRHSKNARRFLKEAREQTVADLVDFPVSFVESVKIPTACVAY
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaataatcattgcctctcttgtcgccttggcgattgccgcctctccggctctt
gaccgtaccttctccccaaagagcgaatacgtctacaaatttgacggacttcttctctct
ggactcccaactacattttccgatgcttcccaaaccctgatttcttgccgtacccgtctt
caagctgttgatgatcgttacattcatcttcaattgattgatattcagtactctgcttcc
cacattccacaatctgagcaatggccaaaaatcaaatctttggagcaacgtgagctttcc
gatgagctcaaagagcttcttgagcttccattccgtgctcaaatcagaaatggacttgtt
tctgagatccaattttcttccgaagatgccgagtggtccaagaacgccaagagatcgatt
ctcaatcttttctctctccgcaagtctgctccagttgatgagatgagccaagatcagaaa
gatatggaatccgacaaagattctcttttcttcaatgttcatgaaaagaccatggaagga
gactgcgaagtcgcttacaccattgttcaagagggagagaagaccatctacaccaaatct
gtcaacttcgacaaatgcatcactcgcccagagactgcttatggtcttcgttttggatct
gagtgcaaggaatgcgagaaggagggacaatttgtcaagccacaaactgtctacacctac
accttcaagaacgagaaattgcaagaatctgaggttcattctatttacactttgaatgtt
aacggacaagaggtcgtcaagtctgagactcgctctaaggtcactttcgtcgaggagagc
aaaatcaacagagagatcaagaaggtctctggaccaaaggaggagatcgtctactccatg
gaaaacgagaagcttattgagcaattctaccaacaaggagaccaggctgaggtcaaccca
ttcaaggctatcgagatggagcagaaggttgagcaacttgatgagatcttccgtcaaatt
caagagcacgagcagaacaccccagaaactgtccaccttattgcccgcgccgtccgcatg
ttccgcatgtgcaccatcgaagaactcaagaaggttcacaccaccatctacactaaggcc
gagaagaaggttcaacttgtcattgaaaccacattggctgtggctggaaccaagaacacc
attcaacacttgattcatcacttcgagaagaagagcatcacaccattgagagctgctgag
cttcttaaatctgtccaagaaactctttacccaagtgagcacattgctgaccttctcatc
caacttgcccaatcgccactctctgagaagtacgaaccacttcgtcaatctgcctggctc
gccgcaggatctgttgttcgtggatttgcttcaaagacccaagaccttccattgatccgc
ccagcatccagacaaaccaaggaaaagtacgtacgcgtattcatgcaacacttccgcaac
gctgactccacatacgagaaggtccttgctcttaagaccctcggaaacgcgggaatcgac
ctttccgtctatgagcttgttcagcttatccaagatccacgtcaaccactttccatccgc
actgaggctgtagatgctcttcgtcttctcaaggacgttatgccacgcaagatccagaag
gttctccttccagtctacaagaaccgtcaaaacaagccagagctccgtatggctgctctt
tggagaatgatgcacaccattccagaagaaccagttcttgctcacatcgtttcccaaatg
gaaaacgaatccaaccaacacgttgctgccttcacctacaacgtcctccgtcaattctcc
aagtctaccaacccatgctaccaacaattggctgttcgttgctccaaggttcttctcttc
acccgttatcaaccacaagaacagatgctctccacctactcccaacttccacttttcaac
tctgagtggctctccggagttcaattcgacttcgccaccattttcgagaagaacgctttc
ttgccaaaggaagttcaagcatcattcgaaaccgtcttcggaggaaactggaacaaatac
ttcgctcaagttggattctctcaacagaactttgagcaagtcatcctcaagaccctcgaa
aaactttctctttacggaaagcaatctgatgaactccgttcccgtcgtgtccaatctgga
atccagatgcttcaagagattgtcaagaagatgaacatccgtccacgtgtccaacaaacc
gattctcaaaatgctcacgctgttttctaccttcgctacaaggagatggactacatcgtt
cttccaattgacatggaaactattgacaatgttgttgagaagtatgtcagaaacggggag
tttgacatcaaatccctcctcactttcttgaccaacgactccaagttcgagcttcaccgt
gctctcttcttctacgaggctgaacgcagaattccaaccaccattggaatgccactcacc
atttctggaaagatgccaactatcctctctatcaacggaaaggtttcaattgagctcgag
aagcttggagctcgtcttgttcttgatatcgttccaactgttgccaccacccacgtcact
gagatgcgcttctggtatccagtcattgaacaaggagtcaagtcacttcaatctgctcgt
ctccacactccattgagattcgaatcaactgttgaattgaagaagaacactctcgaaatc
actcacaagtttgttgtcccagagaacaagaagaccactgtttccgttcatacccgccca
gttgctttcatccgtgttccaaagaaccaagactctgaatatgttgagactgaagagaag
actatttcccactcacaataccaaatgtctactgaagagattgatcgtcaatatgagacc
tttggactcagaatcaatgcccaaggaaatgttctttcccaatggactcttccaatggtc
ttgatgactgaacaagatttcgagttcactcttgagaacaaaaaccgtccagttgagttc
acagctcgcgtcactattggaaacctcgagaagactgatctttccgagatcaagttcgac
aagatcttcgaaaaagaattcgaccttgagaacaacgaatctgagaaccgccgccaatac
ttccacaagatgatccgtgagattcaatccgagcaaggattcaagaatcttattaccctc
aagcttgaggctccacaacaaatgtactggaacactgaacttcgtaccgtctgtgacaaa
tggatccgtatgtgcaaggttgagatggatgctcgtcgctctccaatggagcacgagaac
aaggaatggactcttcgtactgagcttcttgctgcccgcccacaaatgccatcatccctc
cgtcaacttcgtgagcaaccacaccgtgaggttcaacttgcactcaacgccaagtgggga
tcatcaaagaagagcgagatcaccttcaatgctcaactcgaacaatccacggaacaaaag
aagttcctccgcaacatcgagcgtgagtacaagggaattccagagtacgaacttttgatc
aaggctgctcgtcttaaccaagtcaatgttgtttctgagtacaagctcaccccagagtct
gaatacactttctcccgcattttcgaccttatcaaggcatacaacttctggactgtttct
gagaagcgtgtccaaaacgaggatcgccgcgtcgttcttcaactttctgttgagccactt
tcccgccaatacatgaacatgaccatccagactccagaacaagaagttgagttgaagaat
gttcgtattccacgcgtcgttctcccaactattgctcgtcgtgccatgttccaacaaacc
tgggaaaagaccggagccacctgcaaggttggccaatctgaggtttctacctttgacaac
gtgatctaccgtgctccactcaccacctgctactctcttgttgccaaggattgctccgaa
cagccaagattcgctgttcttgccaagaagatcaacaagaactctgaggagcttctcgtt
aaggttgtccgccgtgaggaagaaattgttgtgaagaagtctgacgataagttccttgtc
aaggttgacgaaaagaaggttaacccaactgaacttgaacaatacaatatcgaaattctt
ggagataaccttattgttattcgtcttccacatggagaggttcgtttcgatggatacact
gtcaagaccaacatgccatccgttgcttcacaaaaccaactttgcggactttgcggaaac
aatgacggtgagagagacaatgagttcatgaccgctgacaactacgaaactgaggatgtt
gaggaattccaccgctcttaccttctcaagaacgaagaatgcgaagttgagaacgaccgc
atctccgagaagaagaactacagaaacaaatggaacagagaagagaagaagtccgactac
gtgagcagctccgactatgagaacaactacgatgaaaaggaaactgagaaccaacttttc
aagaagaccctcatcaaggagttctccaaccgcgtctgcttctccatcgagccagtctct
gagtgccgccgtggactcgaatccgagaagacttccaacgagaagatccgtttcacttgc
atgccacgccacagcaagaacgcccgccgtttcttgaaggaggctcgtgagcaaactgtt
gccgatttggtcgatttcccagtctccttcgttgagtctgtcaagatcccaaccgcctgc
gttgcctattaa

DBGET integrated database retrieval system