KEGG   Caenorhabditis elegans (nematode): CELE_F59F4.1Help
Entry
CELE_F59F4.1      CDS       T00019                                 

Gene name
acox-1.6
Definition
(RefSeq) Acyl-coenzyme A oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00071  Fatty acid degradation
cel00592  alpha-Linolenic acid metabolism
cel01040  Biosynthesis of unsaturated fatty acids
cel01100  Metabolic pathways
cel01212  Fatty acid metabolism
cel04146  Peroxisome
Module
cel_M00087  beta-Oxidation
cel_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_F59F4.1 (acox-1.6)
   00592 alpha-Linolenic acid metabolism
    CELE_F59F4.1 (acox-1.6)
   01040 Biosynthesis of unsaturated fatty acids
    CELE_F59F4.1 (acox-1.6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CELE_F59F4.1 (acox-1.6)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     CELE_F59F4.1 (acox-1.6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 181668
NCBI-ProteinID: NP_510603
WormBase: WBGene00010336
Ensembl: WBGene00010336
UniProt: Q93839
Position
X:complement(join(15834122..15834338,15834390..15834848,15834904..15835257,15836396..15836818,15836864..15837047,15837938..15838005,15838060..15838241,15838409..15838525))
Genome map
AA seq 667 aa AA seqDB search
MSRWIQPGDNVDITNERKKATFDTERMSAWIHGGTEVMKRRREILDFVKSVDDFKDPVPT
EFMSREERILNNARKVVAMTNNTDQIDGSDFFGEGMYYQALTMGRDLHAMSLHYVMFIPT
LQGQTDDDQLDEWLTKAISRAVVGTYAQTELGHGTNLSKLETTATYDPATEEFVMNSPTI
TAAKWWPGGLGKSSNYAVVVAQLYTKGECKGPHPFIVQLRDEDTHYPLKGIRLGDIGPKL
GINGNDNGFLLFDKVRIPRKALLMRYAKVNPDGTYIAPAHSKLGYGTMVFVRSIMIKDQS
TQLAAAATIATRYAAVRRQGEITPGKGEVQIIDYQTQQFRVFPQLARAFAFMAAATEIRD
LYMTVTEQLTHGNTELLAELHVLSSGLKSLVSWDTAQGIEQCRLACGGHGYSQASGFPEI
YGYAVGGCTYEGENIVMLLQVARFLMKAAEGVRKGTANLADIGAYIGKPGRKTSRLTTHH
HYTDADIVEDLEHVARKQVFRAYDRLKKAQEHLRPEDAWNSVSVELAKASRWHVRLYLVK
NLLHKVSIAPQDLKIVLFDVARLYAYDIITSSIGAFLEDGYMSSNQMNEVKEGIYKCLSN
MRPNAVGLVDCWDYDDKELKSVLGRRDGNVYPALLQWAQNSQLNRSEVLPAYEKYLGPMM
KDARSKL
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatggattcagccaggcgataatgtagacattaccaatgaacggaaaaaagct
acgtttgacacagaacgtatgtcagcttggatacatggagggactgaagttatgaagcgt
cgccgtgaaattctggattttgtcaaaagcgttgacgacttcaaagatccggttccaaca
gagtttatgtctcgcgaagaacgcattctgaacaatgctcgtaaagttgtggcaatgaca
aataacaccgatcagattgatggatctgacttcttcggagaaggaatgtattatcaagca
ttgacgatgggccgtgatcttcatgcaatgtcgcttcattacgttatgtttattccaaca
cttcaaggtcaaactgacgatgatcaactggacgagtggcttaccaaagcaatttcccgt
gcagtagttggaacttatgctcaaacagaactcggtcatggtacaaacctttcaaaactg
gaaaccactgcaacttatgatccagccacagaagagtttgttatgaactcgccaacaatc
actgcagccaaatggtggccgggaggcttgggtaaatcgtcgaactacgctgtggttgtt
gcacagttgtacacaaaaggagagtgtaaaggacctcatccgttcattgtgcaacttcgc
gatgaagacactcactatccactcaagggaattcgtttgggagatattggaccaaaactt
ggcatcaatggaaatgacaatggattcttacttttcgataaagtcagaattccaagaaaa
gcattgctgatgagatacgcaaaagtgaatccagatggaacttacattgctccggctcat
tccaaattgggatatggaactatggtgtttgtgagatcaattatgatcaaggatcagtcg
actcaacttgcggcagctgcaacaattgctacgagatatgcagcagtgagaagacaggga
gaaatcactccaggaaaaggggaagttcaaatcattgactaccaaacccaacaatttcgt
gtcttccctcaactcgccagagcgtttgctttcatggcagcggccactgaaatccgtgat
ctctacatgacagtcaccgagcagcttacacatggaaacaccgaacttctcgccgagctt
catgtcttgtcttccggtctcaagtcgttagtgtcgtgggatactgctcaaggaattgag
caatgcagattggcgtgtggaggtcatgggtattcacaagcttctggattcccagaaatc
tatggatatgctgttggtggatgcacttacgagggtgaaaatattgtgatgcttctgcaa
gtagcaagattcctgatgaaagcagccgaaggagttagaaaaggaactgctaacctagca
gacatcggagcttacattggaaagcctggaaggaaaacctcgcgcttaacaactcaccac
cactacacagatgctgatatcgttgaagatcttgagcacgttgctcgcaaacaagtattc
cgagcctacgaccgcctgaaaaaggctcaggagcatcttcgtccggaagatgcttggaac
tcggtttctgtggaacttgctaaagcttcgagatggcacgttcgtctgtatctcgtgaag
aacttattgcacaaagtttctattgctcctcaggatttgaagattgtgctcttcgatgtt
gctcggctgtatgcttatgacatcattacatcatcaattggagcatttttggaggatggc
tacatgagctctaatcagatgaatgaagttaaagaaggtatttataaatgcttgtccaat
atgcgtccaaatgcggttggcctagttgactgttgggattatgacgataaagagctcaaa
tcagttttgggaagacgtgacggaaacgtgtaccctgctcttctccagtgggctcaaaat
agtcaactcaacagatcggaagttcttccggcctacgaaaagtatcttggtccaatgatg
aaagacgctcgatcaaaattgtaa

DBGET integrated database retrieval system