KEGG   Caenorhabditis elegans (nematode): CELE_F59F4.2
Entry
CELE_F59F4.2      CDS       T00019                                 

Gene name
serp-1.1
Definition
(RefSeq) SERP1 homolog
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: RAMP4
Other DBs
NCBI-GeneID: 181669
NCBI-ProteinID: NP_001370004
WormBase: WBGene00010337
Ensembl: WBGene00010337
Position
X:join(15841600..15841756,15842083..15842123)
AA seq 65 aa
MAPKQRMTLANKQFSKNVNNRGNVAKSLKPAEDKYPAAPWLIGLFVFVVCGSAVFEIIRY
VKMGW
NT seq 198 nt   +upstreamnt  +downstreamnt
atggccccaaagcaacgtatgacacttgctaacaagcaattctccaagaacgtgaacaac
cgcggaaatgttgccaagagcttgaagccagccgaggacaagtacccagccgccccatgg
ctcatcggacttttcgtctttgtcgtctgcggatccgccgtcttcgagatcatccgctac
gtcaagatgggatggtag

DBGET integrated database retrieval system