KEGG   Caenorhabditis elegans (nematode): CELE_F59F5.6
Entry
CELE_F59F5.6      CDS       T00019                                 

Gene name
syd-2
Definition
(RefSeq) Liprin-alpha
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: SAM_1 SAM_2
Other DBs
NCBI-GeneID: 181255
NCBI-ProteinID: NP_509768
WormBase: WBGene00006364
UniProt: Q21049
Position
X:complement(join(10549510..10549575,10549902..10549964,10550077..10550261,10550314..10550635,10551007..10551325,10551370..10551530,10551589..10551711,10551791..10551944,10552039..10552343,10552435..10552600,10552644..10552870,10552921..10553058,10553104..10553277,10553327..10553443,10553537..10553630,10553869..10554002,10554096..10554227,10554277..10554372,10554444..10554773,10554823..10554936))
AA seq 1139 aa
MSYSNGNINCDIMPTISEDGVDNGGPIDEPSDRDNIEQLMMNMLEDRDKLQEQLENYKVQ
LENAGLRTKEVEKERDMMKRQFEVHTQNLPQELQTMTRELCLLKEQLLEKDEEIVELKAE
RNNTRLLLEHLECLVSRHERSLRMTVMKRQAQNHAGVSSEVEVLKALKSLFEHHKALDEK
VRERLRVAMERVATLEEELSTKGDENSSLKARIATYAAEAEEAMASNAPINGSISSESAN
RLIEMQEALERMKTELANSLKQSTEITTRNAELEDQLTEDAREKHAAQESIVRLKNQICE
LDAQRTDQETRITTFESRFLTAQRESTCIRDLNDKLEHQLANKDAAVRLNEEKVHSLQER
LELAEKQLAQSLKKAESLPSVEAELQQRMEALTAAEQKSVSAEERIQRLDRNIQELSAEL
ERAVQRERMNEEHSQRLSSTVDKLLSESNDRLQLHLKERMQALDDKNRLTQQLDGTKKIY
DQAERIKDRLQRDNESLRQEIEALRQQLYNARTAQFQSRMHAIPFTHAQNIVQQQPQASI
AQQSAYQMYKQQPAQQYQTVGMRRPNKGRISALQDDPNKVQTLNEQEWDRLQQAHVLANV
QQAFSSSPSLADVGQSTLPRPNTAVQHQQDDMMNSGMGMPSGMQGGMQGGMGGGQDAQML
ASMLQDRLDAINTEIRLIQQEKHHAERVAEQLERSSREFYDDQGISTRSSPRASPQLDNM
RQHKYNTLPANVSGDRRYDIYGNPQFVDDRMVRDLDYEPRRGYNQFDEMQYERDRMSPAS
SVASSTDGVLGGKKKRSNSSSGLKTLGRFFNKKKNSSSDLFKRNGDYSDGEQSGTEGNQK
ADYDRRKKKKHELLEEAMKARTPFALWNGPTVVAWLELWVGMPAWYVAACRANVKSGAIM
SALSDQEIQKEIGISNPLHRLKLRLAIQEMVSLTSPSAPRTARLTLAFGDMNHEYIGNDW
LPCLGLAQYRSAFMECLLDARMLEHLSKRDLRTHLRMVDTFHRTSLQYGIMCLKKVNYDK
KVLADRRKACDNINTDLLVWSNERVQRWVEEIGLGVFSRNLVDSGIHGALIALDETFDAS
AFAYALQIGSQDVPNRQLLEKKFIGLVNDHRQQSDPHPRSGSSRKNDSIAKSYEFHLYT
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgagctacagcaatggaaacataaattgtgatataatgccgacaatctcggaagatgga
gtggacaacggcggtcccattgatgaaccatcggaccgagacaacattgagcagctgatg
atgaacatgttggaagaccgggacaaattacaagaacagttggaaaattataaggtgcaa
ctggaaaatgcagggctccgaacgaaagaagttgaaaaagaacgagatatgatgaagaga
cagttcgaagttcatacgcaaaatttaccgcaggaacttcaaacaatgacgcgggaatta
tgcctattaaaagagcagttattagaaaaagatgaagagattgtcgagctcaaagcagaa
cggaacaatactcgacttcttctagagcacctagaatgtttagtttcccgtcatgaaaga
tcactccgaatgacggtcatgaagagacaagctcaaaaccacgctggcgtatcttctgaa
gttgaagttctaaaagctcttaagagtttattcgagcatcacaaggcattggatgaaaaa
gttcgtgaacgtcttcgagtagcaatggagcgtgtggcgacacttgaagaagagctgagc
acaaaaggagatgagaattcgtcgctgaaagcgcgtattgccacttacgcagcagaagcg
gaagaagcaatggcgtcaaatgcacccatcaatggttcaattagcagtgaaagtgcaaac
agacttatcgaaatgcaagaggctttagaaagaatgaaaacagaattagccaactcacta
aaacaatcaactgagatcacaacaagaaatgccgaactcgaggatcaattgacagaagat
gctcgtgaaaaacatgctgcacaggaatcaatcgttcgtttgaagaatcaaatttgcgag
cttgatgcacaacgcaccgatcaagaaactcggataacaacgtttgagtcgcgtttcctg
accgcgcaaagagagtcaacgtgtatccgggacctcaatgacaaattggagcatcagctt
gccaataaagatgcggctgtcaggttgaatgaggaaaaagttcattcacttcaagaaaga
ttggagttggcagagaagcaacttgcacaaagtctcaaaaaagctgaatcccttccgtct
gtagaagccgaattacaacaaagaatggaagcacttacagcagctgaacagaagagtgtt
tctgctgaagagcgcatccaaaggttggaccgaaacattcaagagttgtctgcagagttg
gaaagggctgtgcaaagagaacgcatgaacgaagagcacagccaacggttaagtagcact
gtggacaagcttttatcggaatctaatgatcgccttcaactgcatctcaaagaacgaatg
caagccctcgatgacaaaaatcggttaacacaacagcttgatggaacaaagaaaatttat
gatcaagcggaacgaatcaaagatcgtcttcagcgggataatgaatctctacggcaagag
attgaagctcttaggcaacaattgtacaatgcaagaactgcgcaattccagtcaagaatg
catgcaattccgtttacacatgctcaaaacattgtgcagcaacaaccacaagcttcgatt
gctcagcaatctgcataccaaatgtacaaacaacaaccagctcaacagtatcaaactgta
ggaatgagaagaccaaataaaggaaggatttcagcactccaggacgatccgaacaaagtt
caaaccctcaacgagcaagaatgggatcgacttcaacaagcgcatgttcttgccaacgtc
cagcaagcattttcctcatcaccatcactggccgacgtcggtcaatcgactcttccacgt
cctaacactgctgtccaacaccagcaagatgatatgatgaacagtggaatgggaatgcca
agtggaatgcagggaggaatgcaaggtggaatgggtggtggtcaagatgctcagatgttg
gcatcaatgctacaagatcgcttagatgcaataaatactgaaataagattgattcaacaa
gagaaacatcacgcagaacgggtggctgaacagttagaacgatcaagtcgggaattctat
gatgatcagggaatatctacgagaagttcaccaagagcaagtccccaattagataatatg
cgacaacataagtataacactcttcctgcaaatgtatccggtgaccgacggtatgatatt
tacggcaatccgcagtttgttgacgaccgcatggttagagatttggactacgagccacga
cgagggtacaaccaatttgacgagatgcaatacgaaagagatcgaatgagtccagcttcg
tcagtcgcttcctcgacagatggcgttcttggcggaaagaagaaaagatcgaatagctca
agtggattgaaaacgcttggaaggtttttcaacaaaaagaaaaattcatcgagtgattta
ttcaaacgaaatggagattattcggatggcgagcagtcgggcacagaaggaaaccaaaaa
gctgattacgacaggaggaaaaagaagaagcatgaactattagaggaagccatgaaagca
cgaacaccgtttgctctttggaatggtccaactgttgttgcctggctggagctgtgggtt
ggcatgccagcgtggtatgtagctgcgtgtagagcaaatgtgaaatccggtgcaataatg
tcagctttgagtgatcaagaaatccagaaggagattggaatctcaaacccattgcacagg
ttgaaattgcgacttgcaattcaggaaatggtttctttaacgtcaccatctgccccacga
actgctcgtctgactcttgccttcggagatatgaatcatgaatatattggaaacgactgg
cttccttgtctcggtcttgcgcaataccgatcagcgtttatggaatgtcttcttgacgct
cgaatgttagaacatctttcaaaacgtgacctacgcacgcatctgcgcatggtagacaca
ttccatcgtacaagtctccaatacggaattatgtgtctcaagaaagtcaactatgataag
aaagtgttggcggatcggcgaaaggcgtgtgataatatcaacacagacttgctagtgtgg
tcgaatgaacgagttcagcgatgggtggaagaaatcgggctaggtgtattttcaagaaat
ttagtggatagtggaatacatggtgcattaattgcactggatgaaacgtttgacgcatcc
gcttttgcatatgcactccagattggatctcaagacgttcctaacagacaactactggaa
aagaaattcattggcttagtcaacgatcaccgtcaacaatccgatccccatccgagaagt
ggaagttctcgtaagaatgattccatagcaaaatcctacgagtttcatttatatacctag

DBGET integrated database retrieval system