KEGG   Caenorhabditis elegans (nematode): CELE_H06H21.10Help
Entry
CELE_H06H21.10    CDS       T00019                                 

Gene name
tat-2
Definition
(RefSeq) Phospholipid-transporting ATPase
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CELE_H06H21.10 (tat-2)
Enzymes [BR:cel01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     CELE_H06H21.10 (tat-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 177256
NCBI-ProteinID: NP_001294447
WormBase: WBGene00019166
Ensembl: WBGene00019166
UniProt: U4PBV8
Position
IV:complement(join(4828076..4828111,4828527..4828644,4828751..4828848,4829370..4829586,4829806..4830134,4830942..4831074,4831469..4831862,4832638..4832788,4832916..4833064,4833110..4833197,4834287..4834430,4834637..4834834,4834891..4835016,4835823..4836245,4837247..4837315,4837452..4837732,4838886..4839263,4839455..4839608,4840116..4840250,4840395..4840493,4840543..4840656,4841017..4841171,4841707..4841763,4846890..4846893))
Genome map
AA seq 1349 aa AA seqDB search
MAPVAPVYVPPQQAYNDKPKEESSTKSAKKGGGGGMFSWLPCCSSTSNEKNAPTERRLRA
NDREYNAQFKYADNVIKTSKYNIITFIPQNLFEQFQRIANFYFLVLMILQFIPQISSISW
YSTAVPLVIVLAFSAIKDGYDDAQRHISDRNVNGRKSYVVRNGSLCEEDWSNVKVGDVIR
MMSNQFVAADLLLLSTSEPYGVCFIETMELDGETNLKNRAAIACTQEMGDDLDGITRFDG
EIICEPPNNKLDKFNGKLIWNNHEYGVNNDNILLRGCILKNTRWCYGVVVFAGKDTKLMM
NSGKTKFKRTSLDRFLNILIVGIVLFLIAMCLICTILCAVWEYQTGRYFTIYLPWDDVVP
SPEQRGGRQIALIAFLQFFSYIILLNTVVPISLYVSVEIIRFIHSLWINYDTQMYYENGE
KSVPAKAHTTTLNEELGQVQYVFSDKTGTLTRNIMTFNKCTINGISYGDIYDHKGEVIET
NDKTKSLDFSWNSASEPTFKFFDKNLVDATKRQVPEIDQFWRLLALCHTVMPERDKGQLV
YQAQSPDEHALTSAARNFGYVFRARTPQSITIEVMGNEETHELLAILDFNNDRKRMSVIV
KGPDGKIRLYCKGADMMIMQRIHPSTSQIMRTSTNTHLADFANIGLRTLCLGYKDLDPAY
FSDWDSRVKKASAAMQDRESAVDALYEEIEKDLILIGATAIEDKLQDGVPEAIARLSEAN
IKIWVLTGDKTETAINIAYSCRLLTDETKEIVVVDGQTDTEVEVQLKDTRNTFEQILALP
SPLGGKPRIEIETIHEESEAISSARSMDRNIVTPDLKSAEMAEHESGGVALVINGDSLAF
ALGPRLERTFLEVACMCNAVICCRVTPLQKAQVVDLVKRNKKAVTLSIGDGANDVSMIKT
AHIGVGISGQEGMQAVLASDYSIGQFKYLERLLLVHGRWSYIRMAKFLRYFFYKNFAFTL
TNFWYSFFCGYSAQTVFDAVLIACYNLFFTALPVLAMGSLDQDVDDHYSLRYPKLYLPGQ
FNLFFNMRIFIYSVLHGMFSSLVIFFIPYGAFYNAAAASGKDLDDYSALAFTTFTALVVV
VTGQIAFDTSYWTAISHFVIWGSLVLYFLVCFLLYEWLPVSWIVKTSSSISYGVAFRTMV
TPHFWFSILMVSVVLLLPVMLNRFFWLDTHPSFADRLRIRKKMGKKPSAKDDKKTAFKRT
AATRRSVRGSLRSGYAFSHSQGFGELILKGKLFKNVENLRGKNNSNAKIHPTSDDLQPML
ISSVPDDSQGASSINAMHLPMGTRPQNVPHTLNVNTDDWSQSSDFRPAYAKEPSPLQGTV
IRGDGRSHRNHVYSRETQVEEQPDVITRL
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgttgcaccggtgtatgtgccaccacaacaggcatacaacgataaacctaaa
gaagagtcgtcaacgaaatccgcaaaaaaaggaggtggcggagggatgttcagttggttg
ccatgctgttcaagtacttcaaacgaaaagaatgcgccgacggaacgaagattacgagct
aacgatagggaatataatgcacaattcaaatatgcagacaatgtaatcaaaacgtccaaa
tacaatataatcaccttcattcctcaaaatttattcgaacaattccagcggatagccaac
ttttattttttagttttaatgatattacagtttattcctcaaatttcctcaatttcctgg
tattctacagcggttccactggttattgtattggcattttcagctattaaagatgggtac
gatgatgcgcaaaggcacatatctgatcgaaatgtaaatggtcgaaaatcctacgtagtt
cgaaatggaagtctatgtgaagaagactggagtaatgttaaagttggagatgtgatacga
atgatgagtaatcaatttgtggcggctgatcttctattattatcaacgtcggaaccatat
ggagtatgttttattgaaactatggaattggatggagaaacaaatctgaaaaatcgtgcc
gctattgcatgtacccaggaaatgggcgacgatttggatgggattacgcgctttgatgga
gaaataatctgtgaacctcccaataacaaactagacaagttcaatggaaaattaatatgg
aataatcatgaatatggagttaataatgataatattctgctgagaggatgtattttgaag
aacacgagatggtgttatggagttgtcgtttttgctggaaaagatacaaaattaatgatg
aacagtggaaaaacaaagttcaaaagaacgtctctcgaccgatttttgaatattttaatc
gtcggaattgtgctttttctcattgcaatgtgcctaatttgtacgattttgtgtgctgta
tgggaatatcaaactggaagatattttactatttatctaccgtgggacgatgtggttcct
agtcctgaacaaagaggtggccgccaaattgcccttatcgccttcctccagttcttctcc
tacatcattcttctcaatacagttgtaccaatttctttatatgtgtctgtggaaattatt
cgatttattcattcattatggattaattacgacactcaaatgtattatgaaaatggagag
aaaagtgtcccagcaaaggcacatacaacaactttaaatgaggagttgggacaagttcaa
tatgtgttcagtgacaagactggaacgttgacaaggaatattatgacttttaataagtgt
accattaatgggatctcgtacggagacatttatgatcacaagggagaggttattgagacg
aatgacaaaaccaaatctctcgacttttcctggaattcagcgtccgaacccacattcaaa
tttttcgataaaaatctagttgatgctacaaaacgtcaagtaccagaaattgatcaattc
tggagactactggctctttgtcatactgtaatgcctgaaagagataaaggacaactggtt
tatcaggcacaatcacctgatgaacatgctctaacgtcagctgcaaggaattttggttat
gttttccgagcaagaacgcctcaaagcattacgattgaagtgatgggaaatgaggaaact
catgaattattggcaattcttgattttaataatgatcgaaaaagaatgtctgtaattgtg
aaaggacctgatggaaagattcgattgtattgtaaaggcgctgatatgatgattatgcag
agaatacatccatcaacatctcaaataatgcgtacctcaaccaatactcatctcgctgat
tttgcaaatatcggtcttcgaacgctttgtttgggatacaaggatcttgatccagcgtac
ttttcggattgggattctcgagtcaaaaaggcgtccgcagccatgcaggacagagaatct
gcggtcgatgctctttacgaagaaattgaaaaagatctgatattgattggtgcaacggct
attgaagacaagcttcaggatggtgttccagaggcaattgcaagactttcagaagctaat
atcaagatttgggtgcttaccggggataagacagaaacggctataaacattgcctactcg
tgtcgccttctgaccgatgaaaccaaggaaattgttgtagttgatgggcaaactgatacc
gaagtcgaagtacagctaaaagatacaagaaacacatttgaacagattttggcattgccg
tcaccgcttggaggaaagccacgtattgaaattgagacaatccacgaggagtccgaggct
atttcctctgcaaggagtatggatagaaacattgtaactcctgatttgaaatcagcagaa
atggctgaacacgagagtggaggtgttgctttggtaataaatggagattcattggctttt
gctcttggtccaagacttgaaagaacttttcttgaagtggcttgtatgtgtaatgcagta
atatgttgccgagtgacaccacttcaaaaagctcaagtagttgatctagtaaaacgaaac
aaaaaagcagtgacactttcaattggagacggagcaaatgatgtcagtatgatcaagaca
gctcatattggagttggaatttctggccaagaaggaatgcaagcagtattagcatcagac
tattcaatcggacaattcaaatatcttgaacgtcttcttcttgttcacggtcgatggtct
tacattcgaatggcaaagttcctcagatactttttttacaaaaactttgcatttacactt
accaacttctggtattcattcttctgtggatattctgctcaaacagtttttgacgctgta
ttgattgcttgttacaatctctttttcacagcacttcctgttttggcaatgggatctttg
gatcaagatgttgatgatcattattcactgagatatcctaagctttatctgccgggacag
ttcaatttgttctttaatatgagaatatttatttattctgtacttcatggaatgtttagt
tcccttgtgatattcttcattccatatggtgcattttacaacgcagctgctgcttctgga
aaggatttggacgattactcggctcttgctttcactacttttactgcattagttgtagtt
gttactggacagatagccttcgacacgagttattggacggcaatttcgcattttgtaatc
tggggatcacttgttctgtatttccttgtttgcttccttctttacgaatggcttccagtt
tcatggattgtcaaaacatcatcttcaatctcatatggtgtcgcttttcgaacaatggtt
actcctcacttctggttttcaattctaatggtttcagttgtactgttactaccagttatg
cttaatcgattcttctggcttgatacacatccatcatttgctgataggctgagaattcga
aagaaaatgggcaagaaaccatcggcgaaagatgataaaaaaaccgcattcaaacgcacg
gcagcaactcgacgaagtgtccgtggatcacttagaagtggttacgcattctctcattca
caaggattcggagaactcattctcaaaggaaaattgttcaaaaatgtggaaaatctacgg
ggaaagaataattcgaatgcgaaaattcacccgacttctgatgacttgcagccgatgctt
atttctagtgtgcctgatgacagccaaggagcttcaagtattaatgcaatgcaccttcca
atgggtacacgtccacagaatgtaccccatacattgaatgtaaatactgatgactggtct
caatcatcggatttccgtccagcctatgcaaaggaaccatcaccactgcagggtacagta
atccgtggcgatggacggagccatagaaaccacgtgtattcgcgggaaactcaggtcgaa
gaacaaccagacgtaatcactcgcctttaa

DBGET integrated database retrieval system