KEGG   Caenorhabditis elegans (nematode): CELE_H10D18.2Help
Entry
CELE_H10D18.2     CDS       T00019                                 

Gene name
scl-12
Definition
(RefSeq) SCP-Like extracellular protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 186714
NCBI-ProteinID: NP_504056
WormBase: WBGene00019178
Ensembl: WBGene00019178
UniProt: Q9N5N3
Position
V:join(3812596..3812769,3812820..3812954,3813000..3813217,3813264..3813363)
Genome map
AA seq 208 aa AA seqDB search
MKFALYLIAIFGCATAQFSSTAQTAIVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKW
DSTVASSAQQYANTCPDDHSGTEYGENLYWSWSSSAPTSLDKFGVAASNSWEKEFQDYGW
ESTYMDADLFDSGIGHATQMAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMM
DSDIYQSGDTCSFCPSGSKCEEASGLCP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgctctctacctcattgccatctttggatgcgcaacggctcaattcagctcg
actgctcagactgcaattgtcaaggctcataatgacctgagatctgcaattgctctcggg
aactacgatgctgctggaactatcgagccacctgcagctaacatgcgaaaaattaaatgg
gattccactgtggcaagctctgctcaacaatacgccaatacatgcccagacgatcattct
ggaactgaatacggagagaacctctattggtcctggtcctcttcggctccaaccagtctt
gacaaatttggagttgctgcatcaaactcatgggaaaaggagttccaggattacggatgg
gagtccacatacatggatgctgacctcttcgactctggaatcggacatgctactcaaatg
gcgtgggctgaaactaacaagatcggatgtggtgttaagaattgcggaaaggattcttca
atgaacaatatgtacaaggtcgcagtggtatgccagtacgatcaagctggaaatatgatg
gattcggatatctaccagtctggagacacttgctcgttctgtccatctggatcaaaatgc
gaggaggcatctggactttgcccataa

DBGET integrated database retrieval system