KEGG   Caenorhabditis elegans (nematode): CELE_H10D18.4Help
Entry
CELE_H10D18.4     CDS       T00019                                 

Gene name
scl-13
Definition
(RefSeq) SCP-Like extracellular protein
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 178798
NCBI-ProteinID: NP_504055
WormBase: WBGene00019179
Ensembl: WBGene00019179
UniProt: Q9N5N4
Position
V:complement(join(3810856..3810955,3811005..3811222,3811279..3811413,3811461..3811634))
Genome map
AA seq 208 aa AA seqDB search
MKFALCLLAIFGCATAQFSSTAQGQIVDAHNKLRSAIAQGSYVAAGTQEPSASNMRKIVW
DETVAAAAQEYAEGCPDDHSGTSYGENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGW
TSTFLDEAGFATGIGHATQMAWAETSKIGCGIKNCGKDANKKNMYKVAVVCQYDSAGNMM
DSDIYQQGETCSACSEDASCEQDSGLCA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcgctctttgtcttcttgccatctttggatgcgccactgctcaattcagctca
actgctcagggccagattgtggatgctcataacaagctgagatccgcaatcgctcaggga
agttacgtcgcagcgggaacccaagaaccatcggcttcgaacatgagaaaaattgtttgg
gatgaaacagtggcagctgccgctcaagagtatgccgaaggatgtccagatgatcattct
ggaactagttatggagagaacctctactggtcctggtcttcgtcggctccaagcagtctt
gacaagtttggagttgctgcatcaaattcctgggaaagcgagttccaaaagtacggatgg
acatccacttttctcgatgaagccggttttgctactggaatcggacatgctactcaaatg
gcttgggctgaaactagcaagatcggatgcggaattaaaaattgtggaaaagatgcgaac
aagaaaaacatgtacaaagttgcagtggtctgccaatacgattccgccggtaacatgatg
gactcggacatttaccaacagggagaaacgtgttctgcatgctcggaagatgcaagttgc
gagcaggattctgggctctgtgcttaa

DBGET integrated database retrieval system