KEGG   Caenorhabditis elegans (nematode): CELE_H19N07.1
Entry
CELE_H19N07.1     CDS       T00019                                 

Gene name
erfa-3
Definition
(RefSeq) Tr-type G domain-containing protein
  KO
K03267  peptide chain release factor subunit 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    CELE_H19N07.1 (erfa-3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_H19N07.1 (erfa-3)
   03012 Translation factors [BR:cel03012]
    CELE_H19N07.1 (erfa-3)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     CELE_H19N07.1 (erfa-3)
Translation factors [BR:cel03012]
 Eukaryotic type
  Release factors
   CELE_H19N07.1 (erfa-3)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Other DBs
NCBI-GeneID: 179537
NCBI-ProteinID: NP_001256292
WormBase: WBGene00010405
Ensembl: WBGene00010405
UniProt: O45622
Position
V:complement(join(11110448..11110654,11111104..11111847,11111906..11112313,11112785..11112906,11112953..11113070))
AA seq 532 aa
MSGWNVNASSFVPNANARPFVPGQPYTPQPEQAAPEPTEDWEAQADTSPAAVQPEVAEPV
AVQESAPVAPVSATEAPKKEPTPEEDLVAPLAKKFQRTVYVDDGTHKEHINMVFVGHVDA
GKSTIGGQLMFLTGMVDKRTLEKYEREAKEKGRESWYLSWCMDTNDEEREKGKTVEVGRA
YFETEKRHFTILDAPGHKSFVPNMIVGANQADLAVLVISARRGEFETGFDRGGQTREHSM
LVKTAGVKHLVILVNKMDDPTVKWEEERFKEIEGKLTPFLRKLGFNPKTDITYVPCSGLT
GAFIKDRPTGSEGNWYSGPCFIEFIDVLLPSYKRDFNGPVRCTVAEKYSEMGTVIIGKME
SGCVQKGDTLVVMPNKQPVQVLQIWADDVETERVVAGDNIKFKLKGIEENELQGGFIICS
PDSLAKTGRVFDAEVLVLEHRSIIASGYSCVLHIQSAVEEVTVKGVIATIDKKTGEKKRA
KFVKQDEKCIMRLESPEPFVLEPFKEYPYLGRFTLRDEGKTIAIGKVLKVVE
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcaggctggaacgtgaacgcctcgtcgtttgtgccaaatgcgaatgcacgaccattc
gtccctgggcaaccatacacgcctcaaccagagcaggctgctccagaaccaacagaagat
tgggaagctcaagcagacacatcccctgctgcagttcagccagaagttgctgaaccagtt
gcagttcaagaatctgcgcctgttgcacccgtttccgcaacagaggctccgaaaaaagag
ccaaccccagaagaagaccttgttgctcctctcgccaagaagtttcaacgtaccgtatac
gtcgacgatggcactcacaaagaacacattaacatggtatttgtcgggcacgttgatgct
ggaaagtccaccattggaggacagcttatgttcttaaccggaatggttgacaagcggaca
ctggaaaaatacgagagagaagccaaggaaaagggtcgtgaaagttggtatctttcctgg
tgtatggatacaaacgacgaagaaagagagaagggaaagactgtggaggttggacgtgcc
tatttcgaaaccgagaagcgtcatttcactatcctcgatgcaccgggccacaaatctttt
gtgccaaacatgattgttggagccaatcaagctgatttagctgttctggttatctccgca
cgtcgtggagagtttgaaactggatttgatcggggaggccaaactcgtgaacattctatg
cttgtcaagactgcaggagttaagcatctggtcatcctcgtaaacaagatggacgatcca
accgttaaatgggaagaggagcgtttcaaggaaatcgaaggaaaactcacgccgtttctt
agaaagcttgggttcaatccaaagactgatatcacttatgttccatgttcggggctaact
ggagccttcatcaaggatagaccgacgggatccgaaggaaactggtattcaggtccgtgt
ttcatcgaatttattgatgtgcttctcccatcctacaaacgtgatttcaatggacctgtc
cggtgcactgttgctgaaaaatattctgaaatgggaactgtcattatcggaaagatggaa
tcgggatgtgtgcaaaaaggagatacacttgttgttatgccaaacaaacagcctgttcag
gtgcttcagatttgggcggatgatgtggagactgaacgtgtcgtcgctggagataatatc
aaattcaagctgaagggaattgaagaaaacgaattgcaaggaggattcattatttgctca
ccagattctcttgctaaaactggccgcgttttcgatgctgaagtccttgtcctcgagcac
agatcaattattgcatccggatattcatgtgtattgcatattcaatcagctgtcgaagaa
gtcactgtgaagggagtcattgccacaattgacaagaaaacgggcgaaaagaagcgtgct
aagtttgtgaaacaagacgagaagtgcattatgagactagaaagtcctgaaccattcgta
ctcgagccattcaaagagtatccataccttggaagattcaccctcagagatgaaggaaaa
acaatcgctatcggaaaggtcctcaaagttgtcgagtaa

DBGET integrated database retrieval system