KEGG   Caenorhabditis elegans (nematode): CELE_H21P03.2
Entry
CELE_H21P03.2     CDS       T00019                                 

Gene name
H21P03.2
Definition
(RefSeq) Non-structural maintenance of chromosomes element 4
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: Nse4_C
Other DBs
NCBI-GeneID: 186758
NCBI-ProteinID: NP_502167
WormBase: WBGene00010409
Ensembl: WBGene00010409
UniProt: Q9XTV3
Position
IV:join(11480853..11480918,11480962..11481168,11481217..11481490,11481558..11481717,11481764..11482022,11482070..11482151,11482199..11482344)
AA seq 397 aa
MDGIDPRRMSSKMVADNLCRQPVTADKIEQLRNREEKSATVQCRENHAVAEELKKQISEL
AHIRKSETVDSKIKKLESAVTSLREQSKPLKKALNTALYSTDTELLELVGQTTRETLLEI
NGGAVIDPVDAGNKIGDALKQIETSVKAHTVDKSNWCDEWIVDDNMDEINEMYDDMYKDA
RLSENHRFASRLALFHRLTPELVFASSSKKDDDGPPHYKKFIQPAVYPFNIGCDFIVQLV
DVERVEKQKKIREKVERGAKRKEPAALVKVSDKARNVQSEEVSISKELQHVLKVLKKELK
TRKTDQIDYYELITNPTSFSRTVENMFYVSYLMRDREVYLLEENGVPILKKPTAVNDQEK
LQNDERNSTHGLTPLSFEQWKTLSQKYKTTIIEPLDG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggatggtatcgatcctcgccgcatgagttcaaagatggttgcggacaatttatgtaga
cagccggttacagcggacaaaatcgagcaacttcggaaccgagaggagaaaagtgcaacg
gtgcaatgcagagagaatcatgccgttgccgaagagctaaagaaacagataagcgagctc
gcccatattcggaaatctgaaactgtcgattctaaaattaaaaaactggaatctgctgtt
acgagtttgagagaacaatcgaaaccgctaaaaaaagctctaaacaccgctctctattca
acggacactgaattactagaacttgtcggtcaaacgacgcgtgagactcttctcgaaata
aatggaggtgctgtaattgacccggttgatgctggaaataaaattggagatgctctgaaa
caaatcgagacttctgtgaaagctcatacagtggataaaagtaactggtgcgatgaatgg
attgtcgatgataatatggatgagatcaatgaaatgtacgacgatatgtacaaagacgcc
cgactctcggaaaaccatagatttgcttcacgccttgccctattccaccgtctgactcct
gagctggtttttgcgagcagctcgaaaaaagacgatgatggtcctcctcattataaaaaa
ttcattcagcctgcagtttatccatttaatattggttgcgatttcattgtccaactagtt
gatgttgaacgtgttgagaaacagaaaaagatccgcgagaaggttgagagaggtgcgaag
agaaaagaacccgcagcacttgtcaaagtaagcgataaggcgagaaacgttcaaagtgaa
gaggtttcaatctcaaaagagcttcaacatgttctgaaagttctgaaaaaagagcttaaa
actcggaagacggatcaaatcgactattacgaactcatcacaaatccgactagtttctct
agaacggttgaaaatatgttctacgtctcgtatttgatgcgcgatcgtgaagtttacctg
ctagaagaaaacggtgttccaattctgaaaaaacctaccgctgtgaatgatcaagaaaaa
ttgcaaaatgatgaacgcaactctacccacggacttactcctttgagctttgagcaatgg
aaaacgctctctcaaaaatacaaaaccaccattattgagccactcgatggttaa

DBGET integrated database retrieval system