KEGG   Caenorhabditis elegans (nematode): CELE_H24K24.3Help
Entry
CELE_H24K24.3     CDS       T00019                                 

Gene name
H24K24.3
Definition
(RefSeq) Alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00010  Glycolysis / Gluconeogenesis
cel00071  Fatty acid degradation
cel00350  Tyrosine metabolism
cel00830  Retinol metabolism
cel00980  Metabolism of xenobiotics by cytochrome P450
cel00982  Drug metabolism - cytochrome P450
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CELE_H24K24.3 (H24K24.3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_H24K24.3 (H24K24.3)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_H24K24.3 (H24K24.3)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CELE_H24K24.3 (H24K24.3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CELE_H24K24.3 (H24K24.3)
   00982 Drug metabolism - cytochrome P450
    CELE_H24K24.3 (H24K24.3)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CELE_H24K24.3 (H24K24.3)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CELE_H24K24.3 (H24K24.3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C Glu_dehyd_C Inhibitor_I66
Motif
Other DBs
NCBI-GeneID: 178597
NCBI-ProteinID: NP_001024016
WormBase: WBGene00019240
Ensembl: WBGene00019240
UniProt: Q17335
Position
V:join(911808..911828,911970..912071,913066..913492,914740..915041,915839..916147)
Genome map
AA seq 386 aa AA seqDB search
MSSTAGQVINCKAAVAWSAKAPLSIETIQVAPPKAHEVRVKFQILYTAVCHTDAYTLDGH
DPEGLFPVVLGHEGSGIVESVGEGVTGFAPGDHVVPLYVPQCKECEYCKNPKTNLCQKIR
ISQGNGFMPDGSSRFTCNGKQLFHFMGCSTFSEYTVVADISLCKVNPEAPLEKVSLLGCG
ISTGYGAVLNTCKVEEGSTVAVWGLGAVGLAVIMGAKAAGAKKIVGIDLIESKFESAKFF
GATECINPKSVELPEGKSFQAWLVEQFDGGFDYTFECIGNVHTMRQALEAAHKGWGVSCI
IGVAGAGQEIATRPFQLVTGRTWKGTAFGGWKSVESVPRLVDDYMNKKLLIDEFITHRWN
IDDINTAFDVLHKGESLRSVLAFEKI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaccgctggacaggttatcaactgcaaggcagccgtcgcctggagcgcaaaa
gctccactctcgattgagacgatccaagtggctccaccgaaagcccacgaagttcgagtg
aaatttcagatcctctacaccgcagtctgccacacggacgcctacaccctcgacggacac
gatccggaaggtctcttccctgtcgtcttgggacatgaagggtctggaattgtcgagagc
gtcggagaaggagtcacaggatttgctccaggagatcacgtcgttccgctctacgttcct
cagtgcaaagaatgtgaatattgcaagaatccaaagacgaatctgtgtcaaaagatcaga
atctcgcagggaaatggatttatgcccgatggttcatcgagattcacatgcaacggaaag
cagttgttccattttatgggatgctccacgttcagtgaatacactgttgtggccgacatc
tcactgtgcaaagtgaatccagaagctccgctcgagaaggtttcgcttttgggatgtgga
atttcaactggatacggagccgtgctgaacacgtgcaaagtggaagaagggagtactgta
gccgtatggggactcggtgcagtcggattggccgttatcatgggcgcaaaggctgccgga
gccaagaaaatcgtcggaatcgacctgatcgagtcgaaattcgagtcggccaaattcttc
ggagccaccgaatgcatcaatccgaagagtgttgagcttcctgaggggaagagcttccaa
gcatggctcgtggagcaatttgacggaggatttgactacacttttgagtgtattggaaat
gtgcacacaatgcgccaagccctcgaagccgcccacaaaggatggggagtctcgtgtatc
atcggagtcgccggagccggccaagagatcgccacccgtccattccaacttgtcaccggg
cgcacgtggaagggaaccgcattcggcggatggaaatccgtggaaagtgtgccgagactc
gtcgacgactacatgaacaagaagctgctcatcgatgaattcattactcatcgctggaac
attgacgatatcaatacggcgttcgatgttcttcacaagggagagagtctgcggtcggtg
ctggcgttcgagaaaatataa

DBGET integrated database retrieval system