KEGG   Caenorhabditis elegans (nematode): CELE_H32C10.3Help
Entry
CELE_H32C10.3     CDS       T00019                                 

Gene name
dhhc-13
Definition
(RefSeq) Palmitoyltransferase
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_H32C10.3 (dhhc-13)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CELE_H32C10.3 (dhhc-13)
Membrane trafficking [BR:cel04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    CELE_H32C10.3 (dhhc-13)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHC Ank_2 Ank_3 Ank Ank_4 Ank_5 DUF3687
Motif
Other DBs
NCBI-GeneID: 186797
NCBI-ProteinID: NP_500889
WormBase: WBGene00019257
Ensembl: WBGene00019257
UniProt: Q9TYQ6
Position
IV:join(5917373..5917455,5917620..5917793,5918210..5918321,5918447..5918582,5918856..5919110,5919158..5919256,5919349..5919529,5919839..5919925,5920146..5920465,5921013..5921181,5921231..5921396)
Genome map
AA seq 593 aa AA seqDB search
MPGRLSTIEEKTETSTGAISTTSNTTNSGAEMDSKMHQAVRACQIGEIQTVRFLLNGHVS
ANEFDHEGCGLLHWAAINNKLDIIQLLLSHRADINLIGGNMKSTPLHWACYNSQFGAVMA
LVKNGADPTIKNINGETPLHLAACTGNFIIIAYLLVKFDNIKDTRDNLGRSALMMAADKS
FGLFPIRIFTKVDAYLDFTDDEKGNTALHILAARQNLKGVVELICSGADDTKTDNNGVSA
RDLMDNKFRNLVDKQVTARNICELGTICEKVTSRWFLGQFFTATISGVMIGAATGLYFLT
NFWVVLGGLALTALLLFILVQRRQMDQFGCLPVTYIFWMGIAEFALLIFNSNGLVHWSVL
IFVCSIWVISASFYWILILTNPGVLPRSTTPFKDFIKDLEEKQIDRYCFTCWIPKTSSSH
HCSQCDKCVDGFDHHCPWIHKCVYRKNLRAFVFFCLTIFMFHVFYVLLLLYMIGASMNAS
GFEQTLNDHGLMVISLILAIPHVFGAGAITCTQFSQISRHVSTIEIIRKQRLQRNSSEKT
ITSPEHNPWEYKQSVKTRIRNVCNLLAFDKFGDGEEIDEGHGSSSFETSSSYF
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgcccggacgactttcgacaattgaagagaaaactgaaacttccactggagcaatttca
acaacttccaacacaacaaacagtggcgcagaaatggattcaaaaatgcatcaagcggta
cgtgcctgccaaatcggagaaattcaaaccgttcgatttctgttgaatggacatgtttcg
gctaatgaattcgatcacgaaggatgtggacttcttcattgggctgcaattaataataaa
ttggatattattcaactgctgctttcacatcgcgctgacattaatttaattggaggaaat
atgaaatcgacacctcttcactgggcctgttataattcacaatttggagcagtcatggct
cttgtcaagaatggcgcagatccaacaattaaaaatataaacggcgagactcctcttcac
ttggctgcctgcactggaaactttattataattgcttatttgctcgtaaaatttgataat
atcaaagatacgagagataatttaggtcgttcggcacttatgatggctgctgataagagt
ttcggactatttcctattcgtatattcacaaaagttgatgcatatcttgacttcactgat
gatgagaaggggaatactgctcttcatattttagctgctcgtcagaatttgaaaggagtt
gttgagctgatttgttctggagcagatgacacgaaaaccgataacaatggggtttcagca
cgtgatttgatggacaacaaattccgaaatctagttgacaagcaagtgacagctcgaaat
atttgtgaactgggtacaatttgtgaaaaggttacctctcgctggttccttggccaattt
tttactgcaaccatttcaggtgtaatgattggtgcagcaactggtctatattttctcaca
aacttctgggtggtcttgggtggacttgctttgacagctttattgctttttattttggta
caaagaagacaaatggatcaatttggatgtcttccagtcacttatatcttttggatggga
attgctgaatttgcattgttaattttcaattcaaatggattggttcattggtcggttctg
atttttgtctgctcaatttgggttatttcagcatcgttttattggatcttgatcctaaca
aatcccggtgtccttcctcgttctacaactccgttcaaagatttcatcaaagatctggaa
gagaaacaaatcgatagatactgttttacttgttggattccaaagacttcatcctctcat
cattgctctcaatgtgacaaatgtgtcgatggatttgatcatcattgtccatggattcac
aaatgtgtctatcggaagaatcttcgagctttcgtgtttttctgtcttacaatcttcatg
tttcacgtgttctacgttctattgttgttgtacatgattggtgcctccatgaatgcatcc
ggattcgaacaaaccctaaacgaccatggtttgatggtaatcagtctcatcctcgcaatc
cctcatgttttcggagccggagccatcacttgtactcaattctcacaaatttctcgtcat
gtctctaccatcgagattattcggaaacaaagactccagagaaattctagtgaaaagacc
ataacatcgccagaacataatccatgggaatacaaacaaagtgtgaagactagaattcga
aatgtgtgtaatctattggcatttgacaagtttggagatggagaagaaattgatgaagga
catggatcatcttcattcgaaacatcgtcttcatatttctaa

DBGET integrated database retrieval system