KEGG   Caenorhabditis elegans (nematode): CELE_H40L08.1
Entry
CELE_H40L08.1     CDS       T00019                                 

Gene name
H40L08.1
Definition
(RefSeq) Uncharacterized protein
  KO
K18726  FAS-associated factor 2
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_H40L08.1 (H40L08.1)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     CELE_H40L08.1 (H40L08.1)
SSDB
Motif
Pfam: UBA_4 GET2
Other DBs
NCBI-GeneID: 181603
NCBI-ProteinID: NP_510506
WormBase: WBGene00010433
Ensembl: WBGene00010433
UniProt: O45628
Position
X:complement(join(15081050..15081394,15081868..15082223,15082469..15082643,15082777..15082883,15082928..15083022,15083439..15083566,15083647..15083736,15083834..15083872))
AA seq 444 aa
MDEEHQATIAQMMEITNCEQAVAVDYLTRTNYDVEIAVRHFFEGTIPEPIHNTLNTSAST
PSSSAASLPTTPDEPVPDSRRAVLPRYHSIVQFLAQFFTFPVRLPLIVINFVYSFFFGPR
APVYTHIFDYISQEFPEYDGQKKNVFYKHQLQSLRNDLPTKHWKWLVTYIHEPSGSSDFF
KYLFTSNFSELIKSRGGVFFGCVMGSEDAQRLRPDRAFGRSRRSCILIFVIRGNSLTRKL
LIDDLSNPESVSTNIDLALIDLIADDADRSARNRVQNESRRLMEEQNREYQESLQRDLER
IAKSKSEEEAAKKAQEEEEQKQRDAEERLNTVETYKRTISGDTTLSTGSHDLLIRFPTGK
KVIKFNADDNIEKIFDEAMKSEMCPLFFQMHQSFPKKAVPCLPKWYFEILSAEELEPKSE
CLSNNLTFQEAGITHGSMVYIDNL
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggatgaggaacaccaagcgacgattgctcaaatgatggaaatcacaaattgtgagcag
gctgttgctgtggactatctcacacgcacaaactacgatgttgaaattgcagttcggcac
tttttcgagggcacaattcccgagccaatccacaacacactcaacacatcggcctccaca
ccatcctcgtctgctgcatcgttacccaccacaccagacgagcctgtaccagatagcaga
agggctgtcttgcctagataccactccatagtccagtttcttgctcaattcttcacattc
ccagtcagacttccactcattgttatcaattttgtgtacagtttcttttttggccctcgt
gctccagtgtatacccacatttttgactacatctcacaagagtttcccgaatatgatggg
caaaagaaaaatgtcttttataagcatcagcttcagagtctccgcaacgatctcccaaca
aagcattggaaatggctcgtcacgtacattcatgagccgagtggaagttccgacttcttc
aagtacctcttcacttcaaacttctcagagcttatcaagtcgcgcggtggcgtctttttt
ggatgtgtgatgggatctgaggatgcacaaagactccgacctgaccgtgcgtttggaaga
agccgcagatcttgcattcttatctttgtcatcagaggaaacagtttaacaagaaaattg
ctcatcgatgacctctccaatcctgagtccgtcagcaccaacattgacttggctcttatt
gatctgattgccgacgatgcggatcgttcagcgagaaaccgagttcaaaatgagtctcga
cgactcatggaagagcaaaatcgggagtaccaggaaagcttacagcgtgatttggaacgt
attgcgaagagcaagtctgaagaagaagctgcaaagaaagctcaggaagaagaagaacaa
aagcaacgagatgccgaggagcgtcttaatactgtcgagacttacaaaagaaccatctcc
ggtgacacaactctatcgactggatcacacgatcttctcatccgattcccaacgggcaaa
aaagtgatcaagttcaacgctgacgataatattgaaaagatctttgatgaagctatgaag
tcggaaatgtgcccactgttcttccagatgcaccagagtttcccgaagaaagctgtcccg
tgcctgccaaaatggtactttgagattctctcggcggaggagcttgagccaaaatccgag
tgcctctcgaataacctcacgtttcaagaagctggaatcactcatggttcaatggtgtac
attgacaatttgtga

DBGET integrated database retrieval system