KEGG   Caenorhabditis elegans (nematode): CELE_K03B8.6
Entry
CELE_K03B8.6      CDS       T00019                                 

Gene name
K03B8.6
Definition
(RefSeq) Uncharacterized protein
Organism
cel  Caenorhabditis elegans (nematode)
Motif
Pfam: DUF5655
Other DBs
NCBI-GeneID: 186927
NCBI-ProteinID: NP_505894
WormBase: WBGene00010524
Ensembl: WBGene00010524
UniProt: Q21182
Position
V:join(11407585..11407707,11407895..11408527,11408583..11408741,11409045..11409125)
AA seq 331 aa
MRKPLVVLLLILVTTVESRFVDKMVNSEIGDTYYKHESDPIMIDDKDDAPQYEVNSEEVP
TLPRMNSQTKWEMIRASGQDPTVRRRKNKQHRQQKVVLGRERRDLILAPWRITHVVPKKK
EAEVPKKAMALSFDVCPEKFDAITKGINGRTYVFARERVYQIWFEDGLPQKASYLISEFF
AGGPRTVTAALTNSRSGVTILFDGRTAYRFRWNRKHRRFQLAKNTPQDLPRNITIHPLSA
FEWADGNQVVLSGEHFIIYDAYWNLATFTGHTRKYFPNLPRDLLGIVYNGAGETLLMYTK
TNKLKVYNTKKFKVVQEYPLKLSEFVGCQTR
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaggaagccactggtggtattgctgttgatactggtgacaacggtggagagtcgattc
gtggacaaaatggtcaattcagaaattggagacacctattacaaacacgaatcggatcca
ataatgatcgacgacaaagatgacgcacctcaatacgaagtaaattcggaagaagttcca
actttgccacgtatgaatagtcagaccaaatgggaaatgattcgtgccagtggacaagat
ccaacagtccgtcgtagaaaaaacaagcagcatcgtcagcagaaagtcgtccttggacgt
gaacgtcgtgacttgatccttgctccatggagaatcactcatgttgttccgaaaaagaaa
gaagctgaagttccaaagaaagcaatggctctgtcatttgatgtctgtcctgaaaaattc
gatgcaattacaaagggaatcaatggaagaacctatgtttttgctcgcgaaagggtttat
caaatttggtttgaagacggacttccacaaaaagcgtcttacttgatcagtgaattcttt
gctggaggaccgagaactgtgaccgccgcattgacaaattctcgatctggagtcacaatt
ctctttgatggacgaactgcatacagattccgttggaacagaaaacatcgtagattccag
ctggcgaaaaataccccacaagatcttccccgaaacatcacaatccatccattgtcagca
tttgaatgggccgatggaaatcaagttgttctcagtggtgaacacttcatcatctacgac
gcatactggaacttagccacattcacaggccacacacgcaagtatttcccaaatctgcca
agggatctactgggaatcgtgtacaacggagctggagaaacacttttgatgtacaccaag
acaaacaagttaaaggtttacaacacgaagaagttcaaagtagtacaagaatatccgctg
aaactgtctgaatttgtcggatgtcaaactagatga

DBGET integrated database retrieval system