KEGG   Caenorhabditis elegans (nematode): CELE_K03H1.5
Entry
CELE_K03H1.5      CDS       T00019                                 

Gene name
K03H1.5
Definition
(RefSeq) Uncharacterized protein
  KO
K23820   
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Motif
Pfam: AMOP VWD NIDO Sushi LapA_dom Comm
Other DBs
NCBI-GeneID: 176404
NCBI-ProteinID: NP_499205
WormBase: WBGene00010540
Ensembl: WBGene00010540
UniProt: P34501
Position
III:join(9932416..9932547,9932895..9933329,9933508..9933609,9933749..9934036,9934242..9934304,9934370..9934473,9934521..9934875,9935413..9935633,9935676..9935889,9935936..9936504,9937019..9937245,9937298..9937477,9937568..9937915,9937994..9938287,9938874..9939240,9939291..9939549)
AA seq 1385 aa
MWTARHAVALLVVLTYAYSSILPPGTTFVQSIRDIFRFQEQLKKENVEDTICSETPPESS
IPNRDELLELIRKSKIEDHKFDEHVRKKRQLSRISYQEYLDNLGKADYDVRIEEGWTEIL
YPFGTWAMDKQLMGQAGRETQTNLGFDCPFFGFRFNYTMVYPMGMLSFGLPPFSAPPWTF
PNPAWPKQRDHSFVAAFYADAMFQWIGNTKISNVFFRSVHRPRLDDDEVYERNSQTNYGA
PNYQQAGAQSAANQQFSNPSQYSQNLNAYSQNQQYNTQLLQQQQQIYGKRKKRQMPGRVS
QPGMVVDPWLLDNITRHIQDGYTGANGFRAEHAFIATWYRMAHGGAARALDVSQFEHVKD
WQNTFQVVLASDEIRTFAIFNYARLNWTSSNEAGGLDGFGGKQAAMAGFNGGNGTGWYGL
PYSGEGRLWKLGYFSNVLTPGRWIHRVDEVIIPAGCTNASNGGMMTAPPWGPMHGGMAIN
VSGPCLRPADSVKVNFENWQTSCTRLSRVRARCIMPMFHKIGLVPIRMSRDGGQSFPFFG
KFYVVNSERAPASVSLKDSVDNKTNRWYEPYAQELALGWQAMNLTWNTGARVDISLFGYW
EDADRSHFERIDYLARGISNTGSYSFRPQQLTKQFLLRDAWQKFHFGFVQVALADAEDGV
MWSKPTPFPWYHLHEWERYYGRNWPIDMCIEWFEYDGKRNNFQIDLTTDFPCPCKLPQAM
LDLGRFMPIMDCDKDGDTSCPFNKGAQHCIQSVQPTFSGSSQQCCYDYDGYLMFTDDWEP
DGDYTTFFQPGTPARAHRYGAAPYRLPPFIPTLSNYQLDLNPYRTCCKYADHCEFYYWRR
MTNGCQDYRAPAAGYIYGEPHVITYDGIRYTMPGKGYYVLTMSDSPYHKLMVQVRLEQPD
DTLWHAHVNATVITGVAVQENDSSIVQVYARKPMRRWRYRTDVYVDGTRRFFDKPHWKHQ
QFKHLDIRNPLQNMNQSEIVIMLKSGVGIRIFEGFGMLDVMVTLPPSYNTTCRPGESLSS
SLNAPRGQRRCYTTLGLLGTYNNDPADDLTTPSGTVTRVQNPTTTASTTQMIYEQFASFW
KIDGTNDKIGGVLFQDKFKPIYNPLLFAESDYRPVYWPQTIDMNASRVFTMEQVVSTCQN
NPECEYDFIMTGRKEVGLTTLRRQKEFFALQKTGSKQLISCGPLLKKEGVVKTPPAANYL
DGDKVVFSCKPKYYIHGDIERVCRNGTWSPGWWAWCRDRNLEYALKWMTALLSIFGISLI
FVIFFCILWNIRKKKQAAHAERLQLKEQSDRLNKLENERIFGTSPEKTPLIETDFRSNFN
MNQPSRPIPSQPPSSQYSPPVFAAPPPPSQPTRLPTYTNAISQQQRQFEPPRPPRGNMRF
ETSAI
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgtggacggcacggcacgcggtagcgttgctcgttgtgctcacgtacgcctactcatcc
attttaccacctgggaccacgtttgtacagtcgataagggatatattcaggtttcaggag
caactgaaaaaggaaaacgttgaagatacaatatgctccgaaacacctccagaaagcagc
ataccaaaccgagatgaacttctcgaactcatacgaaaatctaaaattgaagatcataaa
tttgacgaacacgttcgcaaaaagcgtcaactatcccgaataagttatcaagaatatctt
gataacctcggaaaagctgattatgatgttcgaattgaagaaggatggacagaaatttta
tatccatttggaacatgggctatggataaacaacttatgggtcaagctggaagagaaaca
cagactaatttaggatttgattgtccattttttggttttcgatttaattataccatggtg
tatcctatgggaatgctttcatttggacttccaccattttctgctccaccatggactttt
cctaatccagcatggccaaagcaaagggatcattcattcgttgctgcattctatgcggat
gcaatgttccaatggatcggaaataccaaaatcagtaatgttttcttcagaagtgtccat
agaccacgactggacgatgatgaagtttacgagagaaacagtcagacaaactatggggca
ccaaactatcaacaggctggagcacaatcggctgcaaatcaacagttttcaaatcccagc
caatattctcagaatttgaatgcatattcacaaaatcaacaatacaacacacaactttta
caacaacagcaacaaatttatgggaaaaggaagaaaaggcagatgcctggaagagtatct
caaccgggaatggtggttgatccatggcttttggataatattacaaggcatattcaggat
ggatataccggagcaaatggattccgagcagaacatgcatttattgcaacttggtatcgg
atggctcacggtggcgctgctcgagcacttgatgtttctcaattcgagcacgtcaaggat
tggcagaacacgtttcaagtcgtactagcttctgatgaaattcgaacatttgcaattttt
aactatgctcgtctcaattggacatcttcaaatgaagcaggtggtcttgatggattcgga
ggaaaacaggctgcaatggctggattcaatggtggaaacggtactggatggtatggattg
ccgtatagtggagaaggaagattatggaaacttggttatttctcgaatgttttaacacca
ggaagatggattcatagagttgatgaagttattattcctgctggatgtacaaatgcttcg
aatggaggaatgatgacagcaccaccatggggtccaatgcatggaggaatggcaattaat
gtctctgggccgtgcttaaggcctgcggacagtgttaaagtaaactttgaaaattggcag
acaagttgcacccgtttgagccgagtacgtgctcgttgcattatgccaatgttccataaa
attggactagtcccaattcgaatgagtcgtgatggtggacaatctttcccattcttcgga
aaattttatgtagtgaactctgaacgagcccccgcttcagtgtcactcaaagattcggtg
gataacaaaacaaatcgatggtacgaaccttacgcgcaagaattggcactggggtggcaa
gcaatgaatttgacatggaacactggggcaagagtggatattagtttgtttggatattgg
gaagacgctgatcgatcccattttgaaagaatcgattacttggcaagagggatatcaaat
actggatcatattcttttagacctcaacagttaaccaaacagtttttgttgagggatgct
tggcaaaagttccattttggatttgtgcaagttgcactagcagacgctgaggatggtgtc
atgtggagtaaacctacaccattcccatggtaccatttacatgagtgggaacggtattat
ggaaggaattggccaatcgatatgtgcattgaatggtttgaatatgatggaaaacgaaac
aatttccaaattgatttaacaactgactttccatgtccatgcaaattacctcaggctatg
ctagatcttggaagattcatgcctatcatggattgtgataaagatggagatacttcatgt
ccctttaataaaggagcacaacactgtattcaatctgtccagccaacattttctgggtct
tcacaacagtgttgttatgattatgatggctacctaatgttcactgatgactgggaacca
gatggtgattacacgacattcttccaaccaggaactcctgcaagagcacatagatatggt
gcagctccttatagattacctccatttatcccgacactttcaaattatcaattggatttg
aatccatacagaacatgttgcaaatacgctgatcattgtgaattctactattggcgtcgt
atgacaaacggatgtcaagattatcgggcacccgcagctggttatatttacggagaacca
cacgttataacatatgatggaattcgatatacaatgccaggaaagggttattacgttctt
acaatgtcagatagtccatatcataaattgatggttcaagttaggctcgaacaacctgat
gatacactttggcacgcacatgtaaacgcaactgtaataactggagtcgctgttcaagag
aatgatagctcaattgtacaagtttatgcaagaaagccaatgagaagatggagatataga
actgatgtttatgtggatggaacgagaagattctttgataaaccacattggaaacatcaa
caattcaaacaccttgacatccgcaatccactgcaaaacatgaatcagtcggaaattgtt
ataatgttaaagtccggtgtaggaattcgaatcttcgaaggttttggaatgttagatgta
atggttacgcttccgccaagttataatacaacatgccgacctggagaatctctttcctca
tcgttaaacgcgccacgggggcaaaggcgatgttacaccactttagggctactgggaact
tataataatgatccggcggatgatttaacgactccgtcgggaacagtgacaagagttcag
aatccaacgacaacggcttctacaactcagatgatatatgaacaatttgcatcattttgg
aaaatcgatggaacaaacgataaaattggaggagtcctatttcaggacaagttcaaacca
atttacaatccccttctctttgctgaatctgattatcgtcctgtctattggccccagaca
attgatatgaatgcttcccgagttttcacaatggagcaagttgtgagcacgtgccagaat
aatccagagtgtgaatatgattttattatgactggaagaaaggaagtcggattgacaact
cttcgaaggcagaaggaattctttgcacttcagaagactggcagcaagcagttaatatcc
tgtggtccacttctcaaaaaagaaggtgtcgtcaaaactccaccggctgcaaattatttg
gacggggacaaagttgtattctcgtgtaaaccaaaatactacattcacggagacattgaa
cgtgtgtgtagaaacgggacatggtctccgggatggtgggcgtggtgtagagatcgaaat
ttggaatatgcactgaaatggatgactgctttgttatcaatatttggaataagtttgata
tttgtgatattcttctgcattctgtggaatattaggaaaaagaaacaggctgcacatgct
gaaaggttacaactgaaggaacaatctgatcgattgaataaattggaaaatgaaagaata
tttggaacctctcccgaaaagactccgttaattgaaactgactttcgttctaatttcaat
atgaatcaaccttcccgaccaattccatctcaacctccaagctctcagtatagcccgccc
gttttcgctgctccgccgccaccttcacaaccgactagacttccgacttatacaaatgcg
atttcacaacaacaacgtcagttcgaaccaccacgaccgccacgagggaacatgagattt
gagacatcggcaatctga

DBGET integrated database retrieval system