KEGG   Caenorhabditis elegans (nematode): CELE_K04G2.8
Entry
CELE_K04G2.8      CDS       T00019                                 

Gene name
apr-1
Definition
(RefSeq) Adenomatous polyposis coli protein-related protein 1
Organism
cel  Caenorhabditis elegans (nematode)
SSDB
Other DBs
NCBI-GeneID: 172591
NCBI-ProteinID: NP_001021547
WormBase: WBGene00000156
Ensembl: WBGene00000156
UniProt: Q21227
Position
I:join(8050043..8050225,8050430..8050584,8050634..8051360,8051853..8052440,8052482..8054035,8054700..8054981,8055064..8055141)
AA seq 1188 aa
MSSSSSDENETTIHRTGSNTGGSGIYSQPRAGSSKRTSNVRHDVSDVDDEEEHYARFRED
TAIEVDDAITVLLSSLHFEHKRDIVPTDEDDNKLRELHEKIFALITSESDVNRKRRLKKA
LPASNCVREQVYYLRRKPSTPPASYYHRLNAALHTIVKESFGEEYRKVATVLGLVEALAE
VLILEVHTFGINETNPGEHRNIRKLIANALTNLTYGQIHSKRRLCSYDGFIRCVVRIVIE
SPNITQVYAGLIRNLSWNADSGMSEALQPTVHALSIAAVHAHTHRFDVTATLSALWNLAG
HSVENKRTICDTPNCLKVLASLLSPDARFTSLVDSATGILKYVSQYLANTSTHLELRSLL
ITRMLTLLKSASFTCVTNTLGAIANLIVKDPHMQQMIRQDMAAVQQLNVLRNSNRDDIRT
AVKSVLNTLNQPCSHRYGDMSHSVGGGATGMQMLSEPQLQMQTSHHAYHGTASPRLLSLR
ATRASPGKYIQPQAQQQLIQTPQVDQRSSSLPRHFAVQRNGFVMAQSYNQQMDQHQQQQM
IYQLQQQQQIMFQTEDQAQMEHHQQIMYLQQQQQQFHQIQQQQQMQKAQEADPVPPTDDD
LDIPTSTVMGTRSNSERSLGSMNPGSVMTNWNSSLDTAANSSRALSPVSYNDIPASPTMC
AQVFNLPKSTESEHHQLTSQQQNTTHYSSGSANTMTRSDGATTVPMDNIITPTYAILNPI
LVHEQTPNGTVPRKTSEELDSPDDVLPGPSLEEEEGDYAIIGGAAQKTDDELLTRSIQSE
MPTSSSTPKMKVSPRLNGFFSPTQKTTSSPAWSHPDTSPIPKSSSHRTQPNRRQDASDAD
RLLMESIMSEMPKSRIISPRLAGTQQYLEPEPERRSHSKNEEADRRDAFTASHEPSDHNG
IDVARGSDWSPQQQLHRMESLESQASSEDSFGLTAEEPNSSTSGAAANTMRFDDEIDASL
PMDCVDDDDYDYTYDHFEDYEDEEDPDATQFDDGVDAQLTIDCSMISSGSGSSQRNETTT
TSRDSKALATSTPKGSASSLPGVRQATRVSTNGKSRLPVPKTNGSLVDKNPKPIIASRRP
RLPPKPTLLKDKHYPEEDSIENQTRDDTIYVNAPVVEAEQERIYMNALKQQKNIEQSPSI
GNGSPIAKSAIVTPYNYQKPPFTGRNNGEMSNEKSVTPNPKQMLVTIV
NT seq 3567 nt   +upstreamnt  +downstreamnt
atgagctctagtagtagtgatgaaaatgaaacaacgatacacagaacaggatcaaatacc
ggtggaagtggaatctactcacaacctcgagcaggatcatcaaaaagaacatcgaatgtg
cgacatgatgttagtgatgtagatgatgaagaagagcattatgcaagatttcgcgaagat
acggcgatcgaggttgacgatgctataacagttcttctttcatctctacatttcgaacac
aaacgtgatattgttccgaccgatgaagatgataataaacttcgagaacttcacgaaaag
atttttgcattgataacgagtgaatctgatgttaacagaaaaagacggctgaaaaaagct
cttcctgcgtcaaactgtgttagagaacaagtatattatcttcgaaggaaaccatcaaca
ccaccagcttcttattatcatcgactaaatgcagctcttcacacaatcgttaaggaatca
tttggagaagaatatcgaaaagttgctacagtattaggacttgttgaagcgcttgcagaa
gttttaattcttgaagttcacacatttggaatcaatgagaccaatcctggagagcatcga
aatattcgaaaacttattgccaatgctcttacgaatttaacatacggtcaaattcactct
aaacgccggctatgctcatatgatggattcattcgatgcgttgttcgaattgtgatcgaa
tctccaaatataactcaagtatacgctggactaatcagaaatctctcatggaacgccgat
tcaggaatgagtgaagctcttcaaccaacagttcatgcactttcaattgctgcagtacat
gcacatacacatagattcgatgttacagcaacattatctgctttgtggaatcttgctggt
cactcagtagagaataaacgaactatttgtgatactccgaattgtttaaaagtattagcc
agccttctatctcctgatgcaagattcacgtcacttgttgattcagctactggaattctg
aagtatgtatcacaatatctcgcgaatacttccacgcatttagagctaagaagcttgctc
atcactcgaatgctcactttgctcaagagtgcctcgttcacttgtgttacaaatactcta
ggagctattgcaaacctaattgtcaaagatccccacatgcagcaaatgattcggcaggat
atggctgcagtacagcaactcaacgtactccgaaactcgaatcgtgatgatattcggaca
gcagtgaagtctgtgctgaatactcttaatcaaccgtgtagtcatcgttatggtgatatg
tcacattctgttggaggaggagccacagggatgcaaatgctttcggagccacaacttcag
atgcaaacatctcatcatgcttatcatggaactgcgtcaccaagattactatcactgaga
gcaactcgagcatcacctggaaaatatatacaaccacaggctcaacaacagttgatacag
actccacaagttgatcaaagatctagtagtctgccaagacattttgccgttcaacgaaat
ggatttgtgatggcacagtcctacaatcaacaaatggatcaacatcagcaacaacaaatg
atctatcaattgcagcaacaacaacaaattatgtttcagacggaggatcaagcgcaaatg
gaacatcatcaacaaatcatgtaccttcagcagcaacaacaacaatttcatcaaattcaa
caacagcaacaaatgcaaaaagctcaggaagctgatccagttcctcctacggatgacgat
ctagatattcccacatctaccgtaatgggaacacgaagtaacagtgaaagaagtctcggc
tcgatgaatcctggaagtgttatgacaaactggaattcttctctggatactgcagccaac
agttctcgtgctctttctcctgtatcatacaatgatattccagcttctccaacaatgtgt
gctcaggtgttcaatttacctaaatccactgaatcggaacatcatcaattgacgtctcaa
cagcagaacactacacattatagcagtggatcagctaacactatgactcggagtgatggt
gcaactactgtgccaatggataacattattacaccaacttatgctattttgaatccaata
ttggtacacgaacagacaccgaacgggacagttccacgaaagacttcagaagagttggat
agtcctgatgatgttctcccaggtccatctcttgaggaggaagaaggtgattatgctata
ataggaggtgccgcacaaaagacagatgacgagcttttgactcgttctattcaatctgaa
atgcctacttcgtcgtctactccgaagatgaaagtctcgcctcgccttaatggattcttc
tctccaactcagaaaacaacatcgtctcctgcatggtctcatccagatacctcaccgatt
ccaaagtcatcttctcatcgaactcaacctaatcgtcgtcaagatgcttctgatgcagat
cgtcttttaatggaatcaataatgtcagagatgccaaaaagtcgaattatatctccacga
cttgctggtacacaacaatatcttgaacccgagccagagagaagaagtcattcaaaaaac
gaggaagccgatcgccgcgacgcattcaccgcatcgcatgagcccagcgatcataacggc
attgatgtggcaagaggctcagactggtctccacaacaacaattacatcgaatggagtca
ttggaaagccaagctagtagtgaagatagttttggattaactgctgaagaaccaaattca
tcaacttctggtgctgctgcaaacactatgagatttgacgatgagatcgatgcatctctt
ccaatggattgtgtcgatgatgatgattacgactatacttatgatcatttcgaagattat
gaagatgaggaggatcctgatgcgactcagtttgatgatggagttgatgcacaactaact
atcgattgttcaatgatttctagtggaagcggttcatcgcaaagaaatgaaactacgaca
acgtcacgagattcaaaagctttagctacttccacaccaaaaggatctgcatcttcactc
ccaggagttcgacaagccacccgagtatcaacgaatggaaagtcaagactgcctgttcca
aaaacgaatggatcacttgttgataagaatcccaagccaatcatcgcttcccggcggcca
cgattgccaccgaagccgacacttttaaaagataagcactatccagaagaggattcgatt
gagaatcagacgagagatgatacgatatatgtgaatgctccagttgttgaggcagaacaa
gaacgaatttatatgaatgcattgaagcaacagaagaacattgagcaatcaccgtcaatt
ggaaacggatcacctatagctaaatctgcaattgtaacgccctacaattatcagaaaccg
cctttcactggtcgaaataatggtgaaatgagcaacgagaagagtgtgacaccgaatcct
aaacaaatgcttgtaacaatagtctaa

DBGET integrated database retrieval system