KEGG   Caenorhabditis elegans (nematode): CELE_K05F1.3Help
Entry
CELE_K05F1.3      CDS       T00019                                 

Gene name
acdh-8
Definition
(RefSeq) Acyl CoA DeHydrogenase
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00071  Fatty acid degradation
cel00280  Valine, leucine and isoleucine degradation
cel00410  beta-Alanine metabolism
cel00640  Propanoate metabolism
cel01100  Metabolic pathways
cel01200  Carbon metabolism
cel01212  Fatty acid metabolism
Module
cel_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cel_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CELE_K05F1.3 (acdh-8)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CELE_K05F1.3 (acdh-8)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CELE_K05F1.3 (acdh-8)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CELE_K05F1.3 (acdh-8)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     CELE_K05F1.3 (acdh-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 HpaB_N PvlArgDC
Motif
Other DBs
NCBI-GeneID: 173979
NCBI-ProteinID: NP_495142
WormBase: WBGene00019406
Ensembl: WBGene00019406
UniProt: Q21243
Position
II:join(5794555..5794624,5794822..5795648,5795693..5795869,5795968..5796132)
Genome map
AA seq 412 aa AA seqDB search
MLTRLSSGTTWNRIAVQSRQMSFELSDTQKEIQSHAIKFSKDVLVPNAAKFDKSGEFPWE
IVKQAHSLGFMNTIIPEKYGGPGLSNLDTALIVEALSYGCSGLQIAIFGPSLAAAPICLS
GTEEQKKKYLGMLAAEPIIASYCVTEPGAGSDVNGVKTKAVKQGDEYIINGSKAWITGGG
HAKWFFVLARTDDNPKTPAGKAFTAFIVDGDTPGITRGKKENNMGQRCSDTRSITFEDVR
VPKENILGAPGAGFKVAMGAFDLTRPQVAASAVGLAWRCLDESTKYAMERHAFGTPIANH
QGVQFMIADMAINLELSRLFTYRAAAEVDSYGVSSYNASIAKCFAADTANVAATNACQIF
GGAGFNCEYPVEKLMRDAKIYQIYEGTSQIQRMVIGRTLFQNFAKNGTSKMT
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctcactcgtctttcatctggaaccacctggaatcggattgccgttcaaagccgacaa
atgtcatttgaactgtccgacactcaaaaggaaattcagtcccatgctataaaattttcg
aaggacgttcttgtgccaaatgctgcaaaattcgataaaagtggagagtttccatgggaa
atcgtgaaacaggctcactcgctgggattcatgaacacaattattccggagaagtacggt
ggaccaggattatccaatttggataccgccctgattgtggaggccctatcatatggatgt
tctggacttcaaattgctatctttggaccatcgctggcagctgctccgatctgtttgtct
ggaacagaagaacaaaagaaaaagtatttgggaatgttggctgctgaacctatcattgct
tcgtattgtgttacggagcctggagctggatctgatgtgaatggagtcaagacgaaggct
gtgaaacaaggagatgaatatatcatcaatggatcgaaggcgtggattactggtggagga
catgctaaatggttcttcgttcttgcaagaactgatgacaatccaaaaactccagctgga
aaagccttcacggcattcattgttgatggggatactcctggaatcacgagaggaaagaag
gaaaataacatgggacagagatgctctgatacaagatcaatcacttttgaagatgtacgt
gttccaaaggagaacattcttggagctccaggagctggattcaaagtggcaatgggtgca
tttgatttgacacgtcctcaagttgctgccagtgcagttggtctggcatggagatgtctt
gatgaatcaacaaaatatgcaatggaaagacatgcatttggaaccccaattgccaatcat
caaggagttcaattcatgattgcggatatggccatcaaccttgaattgtctcgtttgttc
acatatcgtgccgcagctgaagttgactcttatggtgtctcttcttacaatgcatcaatt
gccaaatgctttgctgccgatactgcaaatgtagcagctaccaatgcttgtcagatcttc
ggaggtgctggattcaactgcgaatatcctgtggaaaaactgatgcgtgatgcaaagatc
tatcaaatctacgagggaacatctcaaattcaacgtatggtcattggtcgcacactgttc
cagaactttgcaaagaatggaaccagcaaaatgacataa

DBGET integrated database retrieval system