KEGG   Caenorhabditis elegans (nematode): CELE_K06A1.5
Entry
CELE_K06A1.5      CDS       T00019                                 

Gene name
atg-16.2
Definition
(RefSeq) Autophagic-related protein 16.2
  KO
K17890  autophagy-related protein 16-1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04136  Autophagy - other
cel04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_K06A1.5 (atg-16.2)
   04136 Autophagy - other
    CELE_K06A1.5 (atg-16.2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_K06A1.5 (atg-16.2)
   03029 Mitochondrial biogenesis [BR:cel03029]
    CELE_K06A1.5 (atg-16.2)
Membrane trafficking [BR:cel04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    CELE_K06A1.5 (atg-16.2)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    CELE_K06A1.5 (atg-16.2)
Mitochondrial biogenesis [BR:cel03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    CELE_K06A1.5 (atg-16.2)
SSDB
Motif
Pfam: WD40 ATG16 WD40_like ZapB CENP-H
Other DBs
NCBI-GeneID: 174067
NCBI-ProteinID: NP_495299
WormBase: WBGene00019427
Ensembl: WBGene00019427
UniProt: Q09406
Position
II:complement(join(6451163..6451253,6451725..6452047,6452100..6452274,6452324..6452967,6453017..6453388))
AA seq 534 aa
MTDNRTSFRLEILNRLCKRERQQRCVKDMFKNYSLLDEQLQQSHRSRSVSVNDEHFKGNV
NDRLAVMKEEMANVYRMKSKNDQDLIDANRKLADSESRYSLVSSQRDKLRIETDAIVKKM
TVLENELAELKEENSVINTERVSLVATCNYLTEKKTQLDNERFQLLNRIRELQEKSAEFM
NAEIALQEERAQMRIREQIAKATADLNLGDERASSAFGTSPETLDEFMMTDVLPSEVKFK
LSTHDGEVHDVEWMSDDTFATAGSDSKVQIWRVSPNKTDASKVSTLSGCLGPVNRLDYDS
QRHVCLASSNDKTCRLWNIDSQRLLSTFSGHTDKVSSARLFQSHNVISGSADRTIKNWDI
SSIRCLKSYLVGSTVFDIVAKCGVSQSSFISSHFDKKVRFWDARSSDATYSVELGQKVSS
LDISMDGLQVLASSRDDTLSLIDVRNYGIIHLYSAEQYKTSCDSTRAIFSSTGEYVLAGS
SNSSVFIWNTKTTKLEKVVKTARSDSAQIMSLAWNPSGRGLLACDRQKTCTLWR
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaccgacaatcggacttcctttcgcttggaaatactgaatcgattgtgcaaacgagaa
cgccagcaaagatgtgtgaaagacatgttcaaaaattattcgttattggatgaacaattg
caacaatcacaccgatcgagatctgtttctgtaaacgatgagcactttaaaggaaatgta
aacgatcgattagctgttatgaaagaagaaatggcaaatgtatacagaatgaaaagtaaa
aatgatcaggaccttattgatgcaaatagaaagttggctgacagtgaatctcgttattct
ctggtttcctcacagagagataaattgagaatagaaaccgatgctattgtaaaaaaaatg
actgtattagagaacgagttggccgaattgaaagaagaaaattctgtgataaacactgaa
agagtatctcttgttgcaacttgcaattatcttaccgagaagaaaacgcagctagataac
gaacgatttcagttattaaacagaatacgtgaactacaggaaaagtctgcggaatttatg
aatgctgaaatagctttgcaagaagaacgcgcacagatgcgaatcagagaacagattgca
aaagctacggctgatttaaatttaggtgacgagcgagcatcttcagcatttggtacatct
cccgaaactttagatgagtttatgatgaccgacgtcttaccatcagaagttaagttcaaa
ttgtctacacacgatggagaagttcatgatgttgaatggatgtctgatgatacatttgcg
acagctggaagtgattcaaaagttcaaatttggagagtttcgccaaataagacggatgct
tcaaaagtttcaactctttctggctgtctgggaccagttaatcgtttggattacgacagt
caacggcatgtatgtcttgcttccagtaacgataaaacatgcagattatggaatattgat
tcgcaaagactattgagtacgttttctggccatacggataaggtttcatctgcaagatta
ttccagtcacacaatgtcatatctggatctgcggatcgtacaatcaagaattgggatatc
agtagtattcgttgtctcaaatcatatcttgttggatccacagtatttgatattgttgct
aaatgtggtgtttctcaatccagcttcatttcttcccattttgataaaaaggttcggttc
tgggatgcacgctcttcagatgcaacgtattcagtagaactcggacaaaaagtcagctct
cttgatatctcgatggatggtcttcaagttcttgcttcatcacgagatgatacactttcc
ttgatcgatgttcgcaactatggaattattcatctctactcagcagaacagtataaaact
agctgtgatagtacgagagcaatcttttcatctacgggagaatatgtgctggctggatct
tcgaattcgtctgttttcatttggaatacaaaaaccacaaagttggaaaaagttgtgaaa
actgcgagatcagattcggctcaaataatgtctctggcatggaatccgtcaggccgaggt
cttctagcttgtgatcgtcagaagacttgtacactctggagatga

DBGET integrated database retrieval system