KEGG   Caenorhabditis elegans (nematode): CELE_K07C6.4Help
Entry
CELE_K07C6.4      CDS       T00019                                 

Gene name
cyp-35B1
Definition
(RefSeq) CYtochrome P450 family
  KO
K17957  cytochrome P450 family 35
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cel00199]
    CELE_K07C6.4 (cyp-35B1)
Cytochrome P450 [BR:cel00199]
 Cytochrome P450, animal type
  CYP35 family
   CELE_K07C6.4 (cyp-35B1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 178803
NCBI-ProteinID: NP_001309511
WormBase: WBGene00019472
Ensembl: WBGene00019472
UniProt: O44650
Position
V:join(3939127..3939306,3939355..3939499,3939545..3939677,3940095..3941004,3941053..3941184)
Genome map
AA seq 499 aa AA seqDB search
MIFVLLLTTFLAVLIIRQYQKARKLPPGPVSLPLIGNIHQLVYHIWNEKGVVPAFDLFRK
KYGDVFTIWLGPIPHVSICNYETSQEVFVKNGNKYKDRFLPPVYLHVSNNLGLFTANGPV
CAEMRKFTLLAFRNMGVGRDLMEQRILDELNTRCAEIDADAVNGKTIVHTTEFFDLTVGS
VINSLLVGKRFEAEDKDDFLEIKRLMAEAADLFTMFDLVVPVWFLKSFFPSRFERVVAIF
EKALNYLSREALARYEKLKTGEYSVNAEDPQDFVEAYLAKMEQERLRDSDTPYTMECLKF
VIGDLWLAGQDTTSTTLVAGFNHLVKNPEIVRKCREEILRITENGSRPLQLKDRAESHYL
NATIAEIQRHASILNVNFWRLVHEPTTVQGHPVDSGSVICAQLGALHVNDDLFKNPDKFY
PERFIENEQLLSQIIPFGIGKRSCVGENIAKSELYLMIGNLILRYDIKPHGSEPSTEDKL
PYSAGKTPDKSVKLEFVKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgattttcgttttgcttctgaccacatttcttgctgttttaataatcaggcaatatcaa
aaagcccgaaaactcccaccaggacctgtttctcttccactaatcgggaatattcatcaa
ttggtgtaccatatttggaatgagaagggagttgtaccagcttttgatttatttagaaaa
aaatatggagacgttttcactatctggcttggtccgatacctcatgtgagtatttgcaac
tatgaaacatcacaggaagtttttgtgaaaaatggaaacaaatacaaagatcgctttctc
cctcctgtttatcttcatgtcagtaataatcttgggttattcaccgcaaatgggccagtg
tgtgccgagatgagaaaattcacgttgttggcgtttagaaatatgggagttgggagagat
ttaatggagcagcggattttggatgagctgaacacgagatgtgccgaaattgatgcagat
gctgtgaatggaaaaacaatcgttcacactacagaatttttcgatctgaccgtcggaagt
gttatcaattctctgctcgtcggaaaacgtttcgaggccgaagataaggatgattttcta
gaaatcaagagactcatggcagaagccgccgatttattcacaatgtttgatttagtagtt
ccggtttggtttttgaaatcattctttccgtcgaggtttgaaagagtagtagcaattttc
gagaaggctttgaactatttatctcgagaagcattggcgcgttatgagaaattaaaaaca
ggagaatattctgtaaatgcagaggatccccaagactttgtagaagcttatttggcaaag
atggagcaggagaggcttcgtgacagtgatacaccatatactatggaatgtttgaaattt
gtgattggagatctctggttagctggtcaagataccacttcaacgactttggtcgcagga
ttcaatcatcttgttaaaaatccagaaattgttagaaaatgcagggaggaaattctgagg
atcacagaaaacgggtcacgtccacttcagctaaaagacagagctgaatctcattacctc
aacgctacaattgcggaaatccaacgccacgcttcaattttaaatgttaacttttggagg
cttgttcatgagccgacaactgtacagggacatccagtggactcaggttcagtgatttgt
gctcaacttggagctcttcatgtaaacgatgatttattcaaaaatcccgacaagttctac
ccggaaagatttattgaaaacgagcaacttttaagtcaaataataccttttggaattgga
aaacgatcgtgtgttggagaaaatattgcaaaatcagagctatacttgatgattggaaat
cttatcctgcgatatgacattaagccacatggttctgaaccttcaacagaagataaactt
ccgtatagcgctggaaaaactcctgataaatctgtgaaattggaatttgttaaattataa

DBGET integrated database retrieval system