KEGG   Caenorhabditis elegans (nematode): CELE_K08C7.2Help
Entry
CELE_K08C7.2      CDS       T00019                                 

Gene name
fmo-1
Definition
(RefSeq) Dimethylaniline monooxygenase [N-oxide-forming]
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    CELE_K08C7.2 (fmo-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     CELE_K08C7.2 (fmo-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 K_oxygenase Pyr_redox NAD_binding_8 NAD_binding_9 ApbA
Motif
Other DBs
NCBI-GeneID: 177954
NCBI-ProteinID: NP_501968
WormBase: WBGene00001476
Ensembl: WBGene00001476
UniProt: G5EDP6
Position
IV:join(10662047..10662203,10662321..10662564,10662615..10662750,10662931..10663371,10663422..10663841,10663890..10663994,10664040..10664138)
Genome map
AA seq 533 aa AA seqDB search
MAPNNKKLLIVGAGASGLPSLRHALLYGIDVTCFERTKDVGGLWHYKPQETELSSVMKTT
VINTSKEMTAYSDFPPESRMANFMHNTEMYRYLLNYSKHYELEKHIKFNHKVNSIDRNED
YEKTGKWKVNYTDDKGATHDAVFDGVMLCSGHHTTPNWPQKFRGQDDFKGRIIHSHSYKD
HRGYEDKVVVVVGIGNSGGDVAVELSRIAKQVYLVTRRGTWVFNRIYDYGQPIDIAMNRK
CISDLRSFVPAWLTNTVVEAKLNQRFDHQAYGLKPSHRVFGAHPTVNDELPNRIACGTVR
IKPNISKFTETGVLFEDGSLIEQVDEIVMSTGFSFEFNLVENGQLIRTHDNQVSLYQYMF
PIELGDHNSLAVIGLVQPFGSIMPLSEMQARVYLEEFTGNHVLPKKNEMTQNVHDKLETM
ARRYVTSRRHTIQVDYVDYIEELAKMIGADLDMKKLWKEDPWLAYKVYFGPCVPYIYRLK
GPHKWNNARDAIMSVDERVLMATNDHAQVAPDYTLLYIVGLIFAIIAVFYILF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaataataaaaagctgctcattgtgggagccggtgcatcagggttgccttct
ttgagacatgcattgctctatggaattgatgtaacttgttttgaaagaacaaaggatgtc
ggaggattgtggcattataaaccacaagagacggaattgtcctctgtcatgaaaactacc
gttatcaacacatcaaaggaaatgacggcatattcggattttcctcccgaatcaagaatg
gcaaacttcatgcataacacagaaatgtacagatacctcttgaattactcgaaacattac
gaactcgaaaaacatataaaatttaatcacaaagtgaattcaatcgatcgaaatgaggat
tatgagaagaccggaaagtggaaagttaattatactgatgacaaaggagctacccatgac
gctgtctttgatggtgttatgttgtgctcgggacatcacactacaccaaattggccacaa
aagttccgaggacaggatgatttcaaaggacggattattcattcacatagttataaagat
catcgtggctatgaagataaagtagtcgttgtagttggaattggaaactctggaggtgat
gttgctgttgaactatcaagaattgccaagcaagtataccttgttactcgtcgtggaaca
tgggtgttcaatagaatttacgattatggacagccaatcgatattgcaatgaacagaaaa
tgcatctctgatctgagatctttcgttccagcgtggctcacgaatacagttgtcgaagcc
aaactgaatcagcgatttgatcatcaagcatatggtttgaaaccaagtcacagagttttt
ggagctcatccgactgtcaatgatgagctgccgaatagaatagcttgcggaaccgtcagg
attaagccaaatatctcaaagttcactgagactggggtcctttttgaagatgggtctttg
attgagcaagttgacgagattgtgatgtctactggattctcatttgaattcaatttggtg
gaaaatgggcaactgattagaactcatgacaatcaagtatccctttaccagtacatgttc
ccaatagaacttggagatcacaacagtcttgcagtcatcggattggtccaaccatttggt
tccattatgccactatctgaaatgcaagcgagagtatatttagaggagtttactgggaat
catgttctcccaaaaaagaatgaaatgactcaaaatgtgcacgataaacttgaaacgatg
gcaagaagatatgtaacaagtcgtcgacatactattcaagtggattatgtcgattatatt
gaagaactcgcgaaaatgattggagccgacttggacatgaagaaactttggaaagaggac
ccatggctagcttacaaggtatactttggtccatgtgttccgtatatttatcgtttgaaa
ggcccacataaatggaataatgcaagagatgcaattatgtcagttgatgaaagagttctt
atggccacgaacgatcacgcacaagtggctcctgactatacattgctgtacatcgttgga
ttaatttttgcaattattgctgtcttttacatcttgttttaa

DBGET integrated database retrieval system