KEGG   Caenorhabditis elegans (nematode): CELE_K08C9.4Help
Entry
CELE_K08C9.4      CDS       T00019                                 

Gene name
col-65
Definition
(RefSeq) COLlagen
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Col_cuticle_N
Motif
Other DBs
NCBI-GeneID: 187138
NCBI-ProteinID: NP_492936
WormBase: WBGene00000641
Ensembl: WBGene00000641
UniProt: Q9XUT4
Position
I:complement(join(11489230..11489846,11490214..11490364,11490423..11490560))
Genome map
AA seq 301 aa AA seqDB search
MSRFLAGTLSAISGIVILGSLVIAGVLFNDINTLYFDVMDDMHEFKLLADDAWNKMITVE
HNAPNTLDSLFKRGKRQSGSSCNCGPQPSNCPAGPAGPPGEPGQPGDDGAPGKAGDNGHD
GIPSPIDAYAQHDCIKCPAGAPGPAGPDGEAGAPGPDGQPGQDGPAGIDGAPGEAGPQGD
AGAAGQDGEAGAPGPAGKNGQRGQGAPGPQGPEGPAGAAGQDGAPGEDGAPGAQGTEGIA
GAPGKDGETGPDGAAGEAGGEGAPGPDAAYCPCPPRTVGYGEVDQPQAEQSGYRRRAARR
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcttcttggccggaactttgtctgccatttctggtattgtgattcttggatca
cttgtgatcgccggtgtcttgttcaatgacatcaacactttgtactttgatgttatggat
gatatgcacgagtttaagctcctcgccgatgacgcgtggaacaagatgatcaccgttgag
cacaatgcaccaaacaccttggatagcttgttcaagcgcggaaagagacagtccggctcg
tcatgcaactgtgggccacagccaagcaactgcccagctggaccagcaggaccaccagga
gagccaggacagccaggagacgacggtgctccaggaaaggccggagacaacggtcacgac
ggaatcccatccccaattgacgcatatgcccaacacgactgcatcaagtgcccagcagga
gccccaggaccagcaggacccgacggagaggctggagccccaggaccagacggacagcca
ggacaagacggaccagctggaattgacggtgccccaggagaggccggaccacaaggagat
gctggagctgctggacaagacggagaggccggagccccgggccccgctggaaagaatgga
caacgcggacaaggagccccaggaccacaaggaccagaaggaccagccggagctgcagga
caagacggtgcaccaggagaggatggagctccaggagcccaaggaactgaaggaatcgcc
ggagcaccaggaaaagacggagagaccggaccagatggagccgctggagaggccggaggt
gaaggagcaccaggaccagacgctgcctactgcccatgcccaccaagaaccgtcggatac
ggagaggttgaccagccacaggctgagcaatccggatacagaagacgtgctgctagacgg
ctctag

DBGET integrated database retrieval system