KEGG   Caenorhabditis elegans (nematode): CELE_K09A9.5Help
Entry
CELE_K09A9.5      CDS       T00019                                 

Gene name
gas-1
Definition
(RefSeq) Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:1.6.5.3 1.6.99.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
Module
cel_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_K09A9.5 (gas-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     CELE_K09A9.5 (gas-1)
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     CELE_K09A9.5 (gas-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Motif
Other DBs
NCBI-GeneID: 181646
NCBI-ProteinID: NP_510569
WormBase: WBGene00001520
Ensembl: WBGene00001520
UniProt: Q93873
Position
X:complement(join(15587019..15587148,15588701..15589346,15589395..15589617,15589838..15590012,15590066..15590199,15590251..15590391))
Genome map
AA seq 482 aa AA seqDB search
MLGRKIAGTCLRANVPSVAATSSTPATQTRNSHTIWYPDAKFERQFKTGGTLGKLWMSER
VSDFDEKIGLDKLEKLAYSDPVMSDNYSGKQREKNLENMILNFGPQHPAAHGVLRLVLKL
EGEVIIKAIPHIGLLHRATEKLIEHKTYTQALPYFDRLDYVSMMCNEQAWSLAVEKLLGI
DIPTRAKYIRTLMGELTRIQNHIMGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGAR
MHANYVRPGGVAWDLPIGLMDDIYDWAIKFPERIDELEDMLTENRIWKARTIDIGLVSAA
DALNWGFSGVMVRGSGIKQDVRKTEPYDAYADMEFDVPIGTKGDCYDRYLCRIEEMRQSL
NIVHQCLNKMPAGEIKVDDHKVVPPKRAEMKENMESLIHHFKFFTEGFQVPPGATYVPIE
APKGEFGVYLVADGTGKPYRCFIRAPGFAHLAAIHDVCYMSLIADIVAVIGTMDIVFGEV
DR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtagaaagatcgccggaacttgtctccgagcgaacgttccatcggtcgcggcg
acgtcttctactcctgccacccaaacccgaaactcccacacaatctggtatccagatgct
aaatttgagcgtcaatttaagaccggaggtaccctcggaaagctgtggatgtcggagcgg
gtttcggatttcgacgagaagatcggacttgacaagcttgaaaagttggcctattccgat
ccagttatgagtgataactacagcggaaaacagagagagaagaatctggaaaacatgatt
ctcaacttcggaccacagcatccagccgctcacggagtgttgcgtctcgtgttgaaactg
gaaggagaagtcatcatcaaggccatcccacatattggactccttcatcgtgccactgaa
aagctcattgagcacaagacctacactcaggctctcccatacttcgatcgtctcgattac
gtctccatgatgtgcaatgagcaggcttggtctttggctgttgagaagcttctcggtatt
gacatcccaacaagagccaaatatatcagaactctcatgggagagctcactcgcatccag
aaccacatcatgggtatcaccactcacgcccttgacgttggagctatgacaccgtttttc
tggatgttcgaggaacgtgaaaagctctttgagttttccgagcgagtatctggtgccaga
atgcatgccaactacgtccgccccggaggtgtcgcttgggatcttccaattggtcttatg
gatgacatctacgactgggccatcaagttcccagaacgtatcgatgagctcgaagacatg
ctcaccgaaaaccgaatctggaaggccagaactattgacatcggacttgtgtcagctgct
gatgctctcaactggggattcagtggagtcatggtccgtggatctggaatcaagcaagac
gtgagaaagaccgaaccatacgatgcctatgctgatatggaatttgatgttccaatcgga
accaagggtgattgctacgacagatacttgtgccgtattgaggagatgagacagtcgttg
aacattgtgcatcagtgcctcaacaagatgccagccggagaaatcaaggtcgacgatcac
aaggttgtgccaccaaagagagccgagatgaaggagaacatggagtctcttattcatcat
ttcaagttcttcaccgaaggattccaagtgccaccaggagcaacttatgtcccaattgag
gctccaaagggagagtttggagtttaccttgttgctgatggaaccggaaaaccatataga
tgcttcatccgcgctccagggtttgctcacttggcggccatccacgatgtgtgctacatg
tctcttatcgccgacattgtcgctgtcattggaactatggatattgtgttcggagaggtc
gatcgataa

DBGET integrated database retrieval system